Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 105116 |
| Name | oriT_pRHBSTW-00184_4  |
| Organism | Klebsiella pneumoniae strain RHBSTW-00184 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP055556 (67132..67180 [-], 49 nt) |
| oriT length | 49 nt |
| IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
| Location of nic site | 32..33 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pRHBSTW-00184_4
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 1585 | GenBank | WP_022644939 |
| Name | WP_022644939_pRHBSTW-00184_4 |
UniProt ID | W8QGP1 |
| Length | 130 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 130 a.a. Molecular weight: 15048.16 Da Isoelectric Point: 4.5248
>WP_022644939.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE
MAKVQAYVSDEVAEKINAIVEKRRVEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNKAL
LEYVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMLRFFPDEDNEVEE
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W8QGP1 |
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 66580..92144
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV113_RS28580 | 62150..62317 | + | 168 | Protein_76 | DUF5431 family protein | - |
| HV113_RS27800 (HV113_27810) | 62265..62387 | + | 123 | WP_085842394 | Hok/Gef family protein | - |
| HV113_RS27805 (HV113_27815) | 63395..63775 | + | 381 | WP_004197740 | hypothetical protein | - |
| HV113_RS27810 (HV113_27820) | 63842..64189 | + | 348 | WP_004197735 | hypothetical protein | - |
| HV113_RS27815 (HV113_27825) | 64277..64507 | + | 231 | WP_004197732 | hypothetical protein | - |
| HV113_RS27820 (HV113_27830) | 64554..65387 | + | 834 | WP_004197739 | N-6 DNA methylase | - |
| HV113_RS27825 (HV113_27835) | 66012..66542 | + | 531 | WP_004197734 | antirestriction protein | - |
| HV113_RS27830 (HV113_27840) | 66580..66987 | - | 408 | WP_009309864 | transglycosylase SLT domain-containing protein | virB1 |
| HV113_RS27835 (HV113_27845) | 67493..67885 | + | 393 | WP_022644939 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HV113_RS27840 (HV113_27850) | 68120..68821 | + | 702 | WP_022644938 | hypothetical protein | - |
| HV113_RS27845 (HV113_27855) | 68906..69106 | + | 201 | WP_032072063 | TraY domain-containing protein | - |
| HV113_RS27850 (HV113_27860) | 69175..69543 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| HV113_RS27855 (HV113_27865) | 69557..69862 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| HV113_RS27860 (HV113_27870) | 69882..70448 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| HV113_RS27865 (HV113_27875) | 70435..71175 | + | 741 | WP_009309865 | type-F conjugative transfer system secretin TraK | traK |
| HV113_RS27870 (HV113_27880) | 71175..72599 | + | 1425 | WP_022644937 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HV113_RS27875 (HV113_27885) | 72713..73282 | + | 570 | WP_032426791 | type IV conjugative transfer system lipoprotein TraV | traV |
| HV113_RS28585 | 73437..73835 | + | 399 | WP_228286649 | hypothetical protein | - |
| HV113_RS27885 (HV113_27895) | 73864..74154 | + | 291 | WP_032426790 | hypothetical protein | - |
| HV113_RS27890 (HV113_27900) | 74178..74396 | + | 219 | WP_004171484 | hypothetical protein | - |
| HV113_RS27895 (HV113_27905) | 74397..74714 | + | 318 | WP_015065629 | hypothetical protein | - |
| HV113_RS27900 (HV113_27910) | 74781..75185 | + | 405 | WP_023320104 | hypothetical protein | - |
| HV113_RS27905 (HV113_27915) | 75210..75608 | + | 399 | WP_015065631 | hypothetical protein | - |
| HV113_RS27910 (HV113_27920) | 75680..78319 | + | 2640 | WP_060446930 | type IV secretion system protein TraC | virb4 |
| HV113_RS27915 (HV113_27925) | 78319..78708 | + | 390 | WP_060446931 | type-F conjugative transfer system protein TrbI | - |
| HV113_RS27920 (HV113_27930) | 78708..79334 | + | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| HV113_RS27925 (HV113_27935) | 79354..80337 | + | 984 | WP_223176982 | conjugal transfer pilus assembly protein TraU | traU |
| HV113_RS27930 (HV113_27940) | 80352..80900 | + | 549 | WP_022631518 | hypothetical protein | - |
| HV113_RS27935 (HV113_27945) | 80875..81564 | - | 690 | WP_032427592 | hypothetical protein | - |
| HV113_RS27940 (HV113_27950) | 81621..82223 | + | 603 | WP_022631520 | hypothetical protein | - |
| HV113_RS27945 (HV113_27955) | 82368..83015 | + | 648 | WP_039698503 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HV113_RS27950 (HV113_27960) | 83074..85029 | + | 1956 | WP_039698502 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HV113_RS27955 (HV113_27965) | 85062..85343 | + | 282 | WP_032419932 | hypothetical protein | - |
| HV113_RS27960 (HV113_27970) | 85333..85560 | + | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| HV113_RS27965 (HV113_27975) | 85571..85897 | + | 327 | WP_020323521 | hypothetical protein | - |
| HV113_RS27970 (HV113_27980) | 85918..86670 | + | 753 | WP_020316647 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HV113_RS27975 (HV113_27985) | 86681..86920 | + | 240 | WP_009309875 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HV113_RS27980 (HV113_27990) | 86892..87449 | + | 558 | WP_064392668 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HV113_RS27985 (HV113_27995) | 87495..87938 | + | 444 | WP_020316643 | F-type conjugal transfer protein TrbF | - |
| HV113_RS27990 (HV113_28000) | 87916..89295 | + | 1380 | WP_177342655 | conjugal transfer pilus assembly protein TraH | traH |
| HV113_RS27995 (HV113_28005) | 89295..92144 | + | 2850 | WP_064392671 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HV113_RS28000 (HV113_28010) | 92157..92705 | + | 549 | WP_049164063 | conjugal transfer entry exclusion protein TraS | - |
| HV113_RS28005 (HV113_28015) | 92889..93620 | + | 732 | WP_064392678 | conjugal transfer complement resistance protein TraT | - |
| HV113_RS28010 (HV113_28020) | 93701..94669 | + | 969 | WP_000654804 | IS5-like element IS903B family transposase | - |
| HV113_RS28015 (HV113_28025) | 94880..95569 | + | 690 | WP_181468471 | hypothetical protein | - |
| HV113_RS28020 (HV113_28030) | 95698..96294 | + | 597 | Protein_121 | TraD N-terminal domain-containing protein | - |
Host bacterium
| ID | 5554 | GenBank | NZ_CP055556 |
| Plasmid name | pRHBSTW-00184_4 | Incompatibility group | IncFIB |
| Plasmid size | 110973 bp | Coordinate of oriT [Strand] | 67132..67180 [-] |
| Host baterium | Klebsiella pneumoniae strain RHBSTW-00184 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |