Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 105036 |
| Name | oriT_p51015_CTX_M_15 |
| Organism | Klebsiella pneumoniae strain 51015 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP050379 (165173..165222 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_p51015_CTX_M_15
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3487 | GenBank | WP_014386205 |
| Name | traD_HB813_RS27295_p51015_CTX_M_15 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85924.97 Da Isoelectric Point: 5.1787
>WP_014386205.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAVAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAVAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 164615..195361
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HB813_RS27040 (HB813_27045) | 159661..160011 | + | 351 | WP_014386186 | hypothetical protein | - |
| HB813_RS27055 (HB813_27060) | 160648..160974 | + | 327 | WP_014386187 | hypothetical protein | - |
| HB813_RS27060 (HB813_27065) | 161036..161248 | + | 213 | WP_014386188 | hypothetical protein | - |
| HB813_RS27065 (HB813_27070) | 161259..161483 | + | 225 | WP_014386189 | hypothetical protein | - |
| HB813_RS27070 (HB813_27075) | 161564..161884 | + | 321 | WP_014386190 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HB813_RS27075 (HB813_27080) | 161874..162152 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| HB813_RS27080 (HB813_27085) | 162153..162566 | + | 414 | WP_013023817 | helix-turn-helix domain-containing protein | - |
| HB813_RS27100 (HB813_27105) | 163399..164220 | + | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| HB813_RS27105 (HB813_27110) | 164253..164582 | + | 330 | WP_014386191 | DUF5983 family protein | - |
| HB813_RS27110 (HB813_27115) | 164615..165100 | - | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| HB813_RS27115 (HB813_27120) | 165491..165907 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HB813_RS27120 (HB813_27125) | 166100..166819 | + | 720 | WP_014386192 | conjugal transfer protein | - |
| HB813_RS27125 (HB813_27130) | 166952..167158 | + | 207 | WP_171773970 | TraY domain-containing protein | - |
| HB813_RS27130 (HB813_27135) | 167220..167588 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| HB813_RS27135 (HB813_27140) | 167602..167907 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| HB813_RS27140 (HB813_27145) | 167927..168493 | + | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| HB813_RS27145 (HB813_27150) | 168480..169220 | + | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| HB813_RS27150 (HB813_27155) | 169220..170644 | + | 1425 | WP_014386194 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HB813_RS27155 (HB813_27160) | 170637..171209 | + | 573 | WP_014386195 | conjugal transfer pilus-stabilizing protein TraP | - |
| HB813_RS27160 (HB813_27165) | 171256..171840 | + | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| HB813_RS27165 (HB813_27170) | 171971..172381 | + | 411 | WP_014386197 | hypothetical protein | - |
| HB813_RS27170 (HB813_27175) | 172386..172677 | + | 292 | Protein_199 | hypothetical protein | - |
| HB813_RS30100 | 172701..172832 | + | 132 | Protein_200 | hypothetical protein | - |
| HB813_RS27175 (HB813_27180) | 172864..173832 | + | 969 | WP_001348255 | IS5-like element IS903 family transposase | - |
| HB813_RS30105 | 173884..173985 | + | 102 | Protein_202 | hypothetical protein | - |
| HB813_RS27180 (HB813_27185) | 173986..174297 | + | 312 | WP_014386200 | hypothetical protein | - |
| HB813_RS27185 (HB813_27190) | 174364..174780 | + | 417 | WP_032408906 | hypothetical protein | - |
| HB813_RS27195 (HB813_27200) | 175145..175543 | + | 399 | WP_014343490 | hypothetical protein | - |
| HB813_RS27200 (HB813_27205) | 175615..178254 | + | 2640 | WP_013214024 | type IV secretion system protein TraC | virb4 |
| HB813_RS27205 (HB813_27210) | 178254..178643 | + | 390 | WP_013214025 | type-F conjugative transfer system protein TrbI | - |
| HB813_RS27210 (HB813_27215) | 178643..179278 | + | 636 | WP_013214026 | type-F conjugative transfer system protein TraW | traW |
| HB813_RS27215 (HB813_27220) | 179313..179714 | + | 402 | WP_004194979 | hypothetical protein | - |
| HB813_RS27220 (HB813_27225) | 179711..180700 | + | 990 | WP_013214027 | conjugal transfer pilus assembly protein TraU | traU |
| HB813_RS27225 (HB813_27230) | 180713..181351 | + | 639 | WP_004193871 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HB813_RS27230 (HB813_27235) | 181410..183365 | + | 1956 | WP_014343489 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HB813_RS27235 (HB813_27240) | 183397..183651 | + | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| HB813_RS27240 (HB813_27245) | 183629..183877 | + | 249 | WP_013214029 | hypothetical protein | - |
| HB813_RS27245 (HB813_27250) | 183890..184216 | + | 327 | WP_013214030 | hypothetical protein | - |
| HB813_RS27250 (HB813_27255) | 184237..184989 | + | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HB813_RS27255 (HB813_27260) | 185000..185239 | + | 240 | WP_032440623 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HB813_RS27260 (HB813_27265) | 185211..185768 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HB813_RS27265 (HB813_27270) | 185814..186257 | + | 444 | WP_013214032 | F-type conjugal transfer protein TrbF | - |
| HB813_RS27270 (HB813_27275) | 186235..187614 | + | 1380 | WP_072157884 | conjugal transfer pilus assembly protein TraH | traH |
| HB813_RS27275 (HB813_27280) | 187614..190436 | + | 2823 | WP_013214034 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HB813_RS27280 (HB813_27285) | 190459..191061 | + | 603 | WP_013214035 | conjugal transfer protein TraS | - |
| HB813_RS27285 (HB813_27290) | 191312..192043 | + | 732 | WP_013214036 | conjugal transfer complement resistance protein TraT | - |
| HB813_RS27290 (HB813_27295) | 192236..192925 | + | 690 | WP_014343485 | hypothetical protein | - |
| HB813_RS27295 (HB813_27300) | 193052..195361 | + | 2310 | WP_014386205 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 5474 | GenBank | NZ_CP050379 |
| Plasmid name | p51015_CTX_M_15 | Incompatibility group | IncFIB |
| Plasmid size | 225540 bp | Coordinate of oriT [Strand] | 165173..165222 [-] |
| Host baterium | Klebsiella pneumoniae strain 51015 |
Cargo genes
| Drug resistance gene | aac(3)-IId, mph(A), sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaOXA-1, aac(6')-Ib-cr, blaCTX-M-15, aph(3')-Ia |
| Virulence gene | - |
| Metal resistance gene | arsR, arsD, arsA, arsB, arsC, arsH, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |