Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105033
Name   oriT_p50595_IncFII in_silico
Organism   Klebsiella pneumoniae strain 50595
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP050373 (58673..58722 [-], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_p50595_IncFII
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3522 GenBank   WP_015632446
Name   Relaxase_HB637_RS27835_p50595_IncFII insolico UniProt ID   R4WBX2
Length   642 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 642 a.a.        Molecular weight: 74631.63 Da        Isoelectric Point: 9.3060

>WP_015632446.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacteriaceae]
MNAIIPPKRRDRKSSFVQLVAYVSVRDDVPLKDELKEDQRFRRPSRSRQAIFDRLVDYMNRSEGTIIEQI
SDMTPEGDIRCSVDGVTCQHNLMSVETAAMEMNSIAMQNLHVKDAVYHYILSWQEDENPSDDQVFDSVKH
SLKRLGMEEHQYVAAIHRDTDNLHVHIAANRVHPVSYRAANVWNDADKLQRTCRELELKHGFKVDNGSWV
RDADNNLVRARKGYRNAPRSARQLEHFSDKESLHHFAVQHVRKPVNTMFREKNASWEKLHQVMNDAGLML
EPSGKGLVVRDVCGDEKLAVKSSRVHPGMTLSRLEPALGTFVPSSRSAEMVKQSVQTPYSDRLHVRDRGA
RAERRQARAEARIDLRERYEKYRNAWKKPDLHAAERFRAVSAAFKEQKTHIRDNEKDAHMRKLMYHIVEF
EREKSMAALRIELKAERRKLYDEGRMRPLTYRAWTEQQALHGDQAALSQLRGWAYRQNRKNRTPQASDSI
IFCAPADDTSLIKADGYDARLYRDGAVVYSRHGQDAIIDRGDRVEVINPYDNGDLNTRIAVDMVAWKSGE
RIEFSRDGSFAYAAGDAVAAHNLHHRDSILVPSNREQYDYTREKFNQLKGRYTDREREAVRQQYDNRYYD
DVRHNDDNSYKP

  Protein domains


Predicted by InterproScan.

(52-307)


  Protein structure


Source ID Structure
AlphaFold DB R4WBX2


T4CP


ID   3486 GenBank   WP_015632442
Name   trbC_HB637_RS27870_p50595_IncFII insolico UniProt ID   _
Length   730 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 730 a.a.        Molecular weight: 82688.74 Da        Isoelectric Point: 5.8919

>WP_015632442.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MQQKQKPVDAARLQRQVHQGMVEEMAYRTGPLLLAIIVIFGAAIVWPVLLWVAIPVMLVWVPMFMLNEFR
MPARMPMDMDRLDPSTETMRPGKLLGFLPVTKLSRHMDNAAGVFYTGYERMLDGGREIWLRMDDLTRHLI
LLATTGAGKTEMLLGFVLNALCWAKGLIFSDGKAQNDVWFAVASLSRRFGREDDLRLLNYITGGQSRSQR
LLENDKSRQQSNNTNPFALAQETYITQLMDSMMPEAGNDRTWQEKAKGMNQVLTKALIYKSRKEQKVMSQ
RLIQEYLSLDKFAELYLQAEAEEWHEEIRTGLRNYLSTSVPGFDMSLITKPSEWSQEARNQHGYLTSQYN
RMLSLFSDTYGHVFSSGAGDIDLRDVVHNDRILVILIPALELSASEALTLGRLTTSQLAMILSQDLGERM
EGKAEDILVIKKFRDRFPFIWLADEVGSYYSDTIGQLATQVRSLGYALVLAGQDLQKLKTAVGDKLWTLL
GNMFTRIFGTITDPTETAEFAAKSAGMEYQAIQDSMEYRPGAISGSYADTGRVTVQEKSKLPFDELQTLN
QGEQATIFKGAVIRNNALYIADDDKITDKDVRINRFVEVEWPTYDSLAHLLPAKVRRDRPRPASINRIMA
IVKNDKIRHAPDSMIIQDGVLYAIADEAMYFDEVAPTPPDAVQRATQLLSLAASVLTETRGRYSVEYPEP
EKLSVKKDEFEKYQHIHQSAVTQQADGFVY

  Protein domains


Predicted by InterproScan.

(442-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 58115..71737

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HB637_RS27640 (HB637_27650) 53132..53482 + 351 WP_004152758 hypothetical protein -
HB637_RS27655 (HB637_27665) 54118..54474 + 357 WP_004152717 hypothetical protein -
HB637_RS27660 (HB637_27670) 54535..54747 + 213 WP_004152718 hypothetical protein -
HB637_RS27665 (HB637_27675) 54758..54982 + 225 WP_004152719 hypothetical protein -
HB637_RS27670 (HB637_27680) 55063..55383 + 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
HB637_RS27675 (HB637_27685) 55373..55651 + 279 WP_004152721 helix-turn-helix transcriptional regulator -
HB637_RS27680 (HB637_27690) 55652..56065 + 414 WP_004152722 helix-turn-helix domain-containing protein -
HB637_RS27700 (HB637_27710) 56899..57720 + 822 WP_004178064 DUF932 domain-containing protein -
HB637_RS27705 (HB637_27715) 57753..58082 + 330 WP_011977736 DUF5983 family protein -
HB637_RS27710 (HB637_27720) 58115..58600 - 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
HB637_RS27715 (HB637_27725) 59034..59426 + 393 WP_004178062 conjugal transfer relaxosome DNA-binding protein TraM -
HB637_RS27720 (HB637_27730) 59640..60335 + 696 WP_004178061 transcriptional regulator TraJ family protein -
HB637_RS27725 (HB637_27735) 60419..60790 + 372 WP_004208838 TraY domain-containing protein -
HB637_RS27730 (HB637_27740) 60844..61212 + 369 WP_004178060 type IV conjugative transfer system pilin TraA -
HB637_RS27735 (HB637_27745) 61226..61531 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
HB637_RS27740 (HB637_27750) 61551..62117 + 567 WP_004152602 type IV conjugative transfer system protein TraE traE
HB637_RS27745 (HB637_27755) 62104..62844 + 741 WP_004152601 type-F conjugative transfer system secretin TraK traK
HB637_RS27750 (HB637_27760) 62844..64268 + 1425 WP_004152600 F-type conjugal transfer pilus assembly protein TraB traB
HB637_RS27755 (HB637_27765) 64261..64857 + 597 WP_004152599 conjugal transfer pilus-stabilizing protein TraP -
HB637_RS27760 (HB637_27770) 64880..65449 + 570 WP_004152598 type IV conjugative transfer system lipoprotein TraV traV
HB637_RS27765 (HB637_27775) 65581..65991 + 411 WP_004152597 lipase chaperone -
HB637_RS27770 (HB637_27780) 65996..66286 + 291 WP_004152596 hypothetical protein -
HB637_RS27775 (HB637_27785) 66310..66528 + 219 WP_004171484 hypothetical protein -
HB637_RS27780 (HB637_27790) 66529..66846 + 318 WP_004152595 hypothetical protein -
HB637_RS27785 (HB637_27795) 66913..67317 + 405 WP_004152594 hypothetical protein -
HB637_RS27790 (HB637_27800) 67613..68011 + 399 WP_004153071 hypothetical protein -
HB637_RS27795 (HB637_27805) 68083..70722 + 2640 WP_004152592 type IV secretion system protein TraC virb4
HB637_RS27800 (HB637_27810) 70722..71111 + 390 WP_004152591 type-F conjugative transfer system protein TrbI -
HB637_RS27805 (HB637_27815) 71111..71737 + 627 WP_004152590 type-F conjugative transfer system protein TraW traW
HB637_RS27810 (HB637_27820) 71781..72143 + 363 Protein_81 TraU family protein -
HB637_RS27815 (HB637_27825) 72207..72911 + 705 WP_001067855 IS6-like element IS26 family transposase -
HB637_RS27820 (HB637_27830) 73167..73487 + 321 WP_015632449 hypothetical protein -
HB637_RS27825 (HB637_27835) 73758..74090 - 333 WP_015632448 hypothetical protein -
HB637_RS27830 (HB637_27840) 74486..74797 + 312 WP_016162079 plasmid mobilization protein MobA -
HB637_RS27835 (HB637_27845) 74800..76728 + 1929 WP_015632446 TraI/MobA(P) family conjugative relaxase -

Region 2: 82305..104146

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HB637_RS27850 (HB637_27860) 77365..77772 + 408 WP_015632445 transposase -
HB637_RS27855 (HB637_27865) 77769..78118 + 350 Protein_90 IS66 family insertion sequence element accessory protein TnpB -
HB637_RS27860 (HB637_27870) 78148..79737 + 1590 WP_015632444 IS66 family transposase -
HB637_RS27865 (HB637_27875) 79760..80065 - 306 WP_015632443 phospholipase D-like domain-containing protein -
HB637_RS27870 (HB637_27880) 80111..82303 - 2193 WP_015632442 F-type conjugative transfer protein TrbC -
HB637_RS27875 (HB637_27885) 82305..83432 - 1128 WP_157787237 thioredoxin fold domain-containing protein trbB
HB637_RS27880 (HB637_27890) 83407..84825 - 1419 WP_015632440 hypothetical protein trbA
HB637_RS27885 (HB637_27895) 84927..85550 - 624 WP_015632439 plasmid IncI1-type surface exclusion protein ExcA -
HB637_RS27890 (HB637_27900) 85616..87760 - 2145 WP_015632438 DotA/TraY family protein traY
HB637_RS27895 (HB637_27905) 87802..88383 - 582 WP_015632437 conjugal transfer protein TraX -
HB637_RS27900 (HB637_27910) 88380..89576 - 1197 WP_015632436 conjugal transfer protein TraW traW
HB637_RS27905 (HB637_27915) 89587..92634 - 3048 WP_015632435 conjugal transfer protein traU
HB637_RS27910 (HB637_27920) 92644..92958 - 315 WP_123677146 hypothetical protein traT
HB637_RS27915 (HB637_27925) 93251..93652 - 402 WP_015632433 DUF6750 family protein traR
HB637_RS27920 (HB637_27930) 93706..94239 - 534 WP_015632432 conjugal transfer protein TraQ traQ
HB637_RS27925 (HB637_27935) 94249..94968 - 720 WP_015632431 conjugal transfer protein TraP traP
HB637_RS27930 (HB637_27940) 94974..96314 - 1341 WP_015632430 conjugal transfer protein TraO traO
HB637_RS27935 (HB637_27945) 96318..97421 - 1104 WP_015632429 DotH/IcmK family type IV secretion protein traN
HB637_RS27940 (HB637_27950) 97432..98136 - 705 WP_015632428 DotI/IcmL/TraM family protein traM
HB637_RS27945 (HB637_27955) 98172..98525 - 354 WP_015632427 hypothetical protein traL
HB637_RS27950 (HB637_27960) 98559..101882 - 3324 WP_032495745 LPD7 domain-containing protein -
HB637_RS27955 (HB637_27965) 101900..102166 - 267 WP_032441926 IcmT/TraK family protein traK
HB637_RS27960 (HB637_27970) 102163..103350 - 1188 WP_032495744 plasmid transfer ATPase TraJ virB11
HB637_RS27965 (HB637_27975) 103328..104146 - 819 WP_015632425 type IV secretory system conjugative DNA transfer family protein traI
HB637_RS27970 (HB637_27980) 104143..104610 - 468 WP_015632424 DotD/TraH family lipoprotein -
HB637_RS27975 (HB637_27985) 104633..105112 - 480 WP_015632423 lytic transglycosylase domain-containing protein -
HB637_RS27980 (HB637_27990) 105810..106121 - 312 WP_015632421 hypothetical protein -
HB637_RS27985 (HB637_27995) 106155..106358 - 204 WP_032495743 hypothetical protein -
HB637_RS27990 (HB637_28000) 106376..106909 - 534 WP_015632420 transcription termination/antitermination NusG family protein -
HB637_RS27995 (HB637_28005) 107177..107755 + 579 WP_015632419 hypothetical protein -
HB637_RS28000 (HB637_28010) 107737..108207 + 471 WP_032441927 hypothetical protein -
HB637_RS28005 (HB637_28015) 108207..108593 + 387 WP_015632417 acyl-CoA thioesterase -


Host bacterium


ID   5471 GenBank   NZ_CP050373
Plasmid name   p50595_IncFII Incompatibility group   IncFIB
Plasmid size   127925 bp Coordinate of oriT [Strand]   58673..58722 [-]
Host baterium   Klebsiella pneumoniae strain 50595

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   silP, silA, silB, silF, silC, silR, silS, silE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9