Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 105032 |
| Name | oriT_p50595_ERM |
| Organism | Klebsiella pneumoniae strain 50595 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP050372 (69493..69578 [-], 86 nt) |
| oriT length | 86 nt |
| IRs (inverted repeats) | 61..68, 73..80 (TTGGTGGT..ACCACCAA) 27..34, 37..44 (GCAAAAAC..GTTTTTGC) 8..14, 20..26 (TGATTTA..TAAATCA) |
| Location of nic site | 53..54 |
| Conserved sequence flanking the nic site |
TGTGTGGTGC |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 86 nt
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Auxiliary protein
| ID | 1569 | GenBank | WP_001354030 |
| Name | WP_001354030_p50595_ERM |
UniProt ID | A0A734M5H3 |
| Length | 127 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14508.47 Da Isoelectric Point: 4.7116
MARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDEE
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A734M5H3 |
| ID | 1570 | GenBank | WP_000089263 |
| Name | WP_000089263_p50595_ERM |
UniProt ID | A0A3U3XJL9 |
| Length | 75 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 75 a.a. Molecular weight: 8541.74 Da Isoelectric Point: 8.6796
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3U3XJL9 |
T4CP
| ID | 3484 | GenBank | WP_000069777 |
| Name | traC_HB637_RS26910_p50595_ERM |
UniProt ID | _ |
| Length | 876 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 876 a.a. Molecular weight: 99195.86 Da Isoelectric Point: 6.1126
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
| ID | 3485 | GenBank | WP_025985153 |
| Name | traD_HB637_RS27010_p50595_ERM |
UniProt ID | _ |
| Length | 747 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 747 a.a. Molecular weight: 84960.70 Da Isoelectric Point: 5.1644
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIYWWCTSLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPEEEMEQQLPPGISESG
EVVDMAAYEAWQQENHPDIQQHMQRREEVNINVHRERGEDVEPGDDF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1546..21440
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HB637_RS26890 (HB637_26900) | 57..278 | + | 222 | WP_001278683 | conjugal transfer protein TraR | - |
| HB637_RS26895 (HB637_26905) | 271..747 | + | 477 | WP_000549587 | hypothetical protein | - |
| HB637_RS26900 (HB637_26910) | 827..1045 | + | 219 | WP_000556745 | hypothetical protein | - |
| HB637_RS26905 (HB637_26915) | 1073..1420 | + | 348 | WP_000836682 | hypothetical protein | - |
| HB637_RS26910 (HB637_26920) | 1546..4176 | + | 2631 | WP_000069777 | type IV secretion system protein TraC | virb4 |
| HB637_RS26915 (HB637_26925) | 4173..4559 | + | 387 | WP_000214084 | type-F conjugative transfer system protein TrbI | - |
| HB637_RS26920 (HB637_26930) | 4556..5188 | + | 633 | WP_001203728 | type-F conjugative transfer system protein TraW | traW |
| HB637_RS26925 (HB637_26935) | 5185..6177 | + | 993 | WP_000830838 | conjugal transfer pilus assembly protein TraU | traU |
| HB637_RS26930 (HB637_26940) | 6207..6512 | + | 306 | WP_000224416 | hypothetical protein | - |
| HB637_RS26935 (HB637_26945) | 6521..7159 | + | 639 | WP_001080256 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HB637_RS26940 (HB637_26950) | 7156..9006 | + | 1851 | WP_000821856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HB637_RS26945 (HB637_26955) | 9033..9290 | + | 258 | WP_000864353 | conjugal transfer protein TrbE | - |
| HB637_RS26950 (HB637_26960) | 9277..10026 | + | 750 | WP_001336806 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HB637_RS26955 (HB637_26965) | 10040..10384 | + | 345 | WP_000556796 | conjugal transfer protein TrbA | - |
| HB637_RS26960 (HB637_26970) | 10503..10787 | + | 285 | WP_000624194 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HB637_RS26965 (HB637_26975) | 10774..11319 | + | 546 | WP_000059831 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HB637_RS26970 (HB637_26980) | 11249..11596 | + | 348 | WP_001309242 | P-type conjugative transfer protein TrbJ | - |
| HB637_RS30370 | 11577..11654 | + | 78 | Protein_17 | conjugal transfer protein TrbF | - |
| HB637_RS26980 (HB637_26990) | 12423..12746 | + | 324 | Protein_19 | F-type conjugal transfer protein TrbF | - |
| HB637_RS26985 (HB637_26995) | 12724..14106 | + | 1383 | WP_001309243 | conjugal transfer pilus assembly protein TraH | traH |
| HB637_RS26990 (HB637_27000) | 14103..16925 | + | 2823 | WP_001007039 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HB637_RS26995 (HB637_27005) | 16941..17426 | + | 486 | WP_000605870 | hypothetical protein | - |
| HB637_RS27000 (HB637_27010) | 17475..18206 | + | 732 | WP_000782451 | conjugal transfer complement resistance protein TraT | - |
| HB637_RS27005 (HB637_27015) | 18409..19146 | + | 738 | WP_000199905 | hypothetical protein | - |
| HB637_RS27010 (HB637_27020) | 19197..21440 | + | 2244 | WP_025985153 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 68925..76309
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HB637_RS27270 (HB637_27280) | 64897..65331 | + | 435 | WP_000845953 | conjugation system SOS inhibitor PsiB | - |
| HB637_RS27275 (HB637_27285) | 65328..66047 | + | 720 | WP_001276217 | plasmid SOS inhibition protein A | - |
| HB637_RS30145 | 66269..66418 | + | 150 | Protein_79 | plasmid maintenance protein Mok | - |
| HB637_RS27280 (HB637_27290) | 66360..66485 | + | 126 | WP_001372321 | type I toxin-antitoxin system Hok family toxin | - |
| HB637_RS29915 | 66804..67100 | - | 297 | Protein_81 | hypothetical protein | - |
| HB637_RS27295 (HB637_27305) | 67400..67696 | + | 297 | WP_001272251 | hypothetical protein | - |
| HB637_RS27300 (HB637_27310) | 67807..68628 | + | 822 | WP_001234445 | DUF932 domain-containing protein | - |
| HB637_RS27305 (HB637_27315) | 68925..69515 | - | 591 | WP_000252683 | transglycosylase SLT domain-containing protein | virB1 |
| HB637_RS27310 (HB637_27320) | 69850..70233 | + | 384 | WP_001354030 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HB637_RS27315 (HB637_27325) | 70427..71098 | + | 672 | WP_000283561 | conjugal transfer transcriptional regulator TraJ | - |
| HB637_RS27320 (HB637_27330) | 71235..71462 | + | 228 | WP_000089263 | conjugal transfer relaxosome protein TraY | - |
| HB637_RS27325 (HB637_27335) | 71495..71854 | + | 360 | WP_001098992 | type IV conjugative transfer system pilin TraA | - |
| HB637_RS27330 (HB637_27340) | 71869..72180 | + | 312 | WP_000012113 | type IV conjugative transfer system protein TraL | traL |
| HB637_RS27335 (HB637_27345) | 72202..72768 | + | 567 | WP_000399780 | type IV conjugative transfer system protein TraE | traE |
| HB637_RS27340 (HB637_27350) | 72755..73483 | + | 729 | WP_001230772 | type-F conjugative transfer system secretin TraK | traK |
| HB637_RS27345 (HB637_27355) | 73483..74934 | + | 1452 | WP_000146675 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HB637_RS27350 (HB637_27360) | 74924..75490 | + | 567 | WP_000896599 | conjugal transfer pilus-stabilizing protein TraP | - |
| HB637_RS27355 (HB637_27365) | 75477..75797 | + | 321 | WP_001057307 | conjugal transfer protein TrbD | - |
| HB637_RS27360 (HB637_27370) | 75794..76309 | + | 516 | WP_000809881 | type IV conjugative transfer system lipoprotein TraV | traV |
Host bacterium
| ID | 5470 | GenBank | NZ_CP050372 |
| Plasmid name | p50595_ERM | Incompatibility group | IncFII |
| Plasmid size | 76387 bp | Coordinate of oriT [Strand] | 69493..69578 [-] |
| Host baterium | Klebsiella pneumoniae strain 50595 |
Cargo genes
| Drug resistance gene | erm(B), mph(A) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |