Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104957
Name   oriT_pSA20083530.1 in_silico
Organism   Salmonella enterica strain SA20083530
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP030204 (71842..71923 [-], 82 nt)
oriT length   82 nt
IRs (inverted repeats)      44..49, 52..57  (CCGCGC..GCGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_pSA20083530.1
CGGGGTGTCGGGGCGAAGCCCTGACCAGGTGGTAAATGTATGGCCGCGCGTGCGCGGTTATACATTTACACATCCTGTCCCG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3483 GenBank   WP_114047640
Name   nikB_CHD70_RS27305_pSA20083530.1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104105.46 Da        Isoelectric Point: 7.2080

>WP_114047640.1 IncI1-type relaxase NikB [Salmonella enterica]
MNAIIPKKRRDGKSSFEDLVSYVSVRDDVEDEELHALSSVQSELSHRSRFSRLVDYATRLRDESFVSLVD
VMKDGCEWVNFYGVTCFHNCTSLETAAEEMEYTARQARYAKDDTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKALGLPEHQYVSAVHTDTDNLHVHVAVNRVHPDTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
IHAPGNRIVRKTAVERDRQNAWKRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQQNGS
FMVTDGWDRNREGVQLDSFGPSWSGEKLRKKMGEYTPVPNDIFSQVVTPGRYKPEAVAADTRPEKIAETE
SLMQYACRHTGERLPEMAREGQLESCQAIHRTLAEAGLWMRIQHGHLVICDGYDHNQTPVRADSVWSLLT
LENVKQLSGGWQPVPTDIFRQVTPTERFSGRRLEICPASDKEWHRMRTGTGPQGAIRRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLARAEP
QAGPFVSAPADLFDRVKPESRYNPELAVSDKYGISSKRDPMLRRQRREARAEARADLRARYLAWRTQWCK
PDLRYGERCRDIHQACRLRKSHIRAQYDDPVLRKLHYHIAEVQRMQALIRLKEEVRDERQKLIADGKWYP
PSYRQWVETQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTADRCVILCEPGGTPVYENRGDLEARLQKNGS
VRFRDRRTDQFVCTDYGDRVVFHNHHDRNELADKLDLIAPVLFERDPRIGFEPEGNDRQFNQVFAEMVAW
HNVTERTGHGDYTISRPDVDHHREGCERYYRDYIDANSSNETSLPSPEQEKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(63-315)


  Protein structure



No available structure.




Auxiliary protein

ID   1551 GenBank   WP_114047639
Name   WP_114047639_pSA20083530.1 insolico UniProt ID   _
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12699.62 Da        Isoelectric Point: 10.7418

>WP_114047639.1 plasmid mobilization protein MobA [Salmonella enterica]
MSDKRERSGSERRQKTLLRAVRFSPDEDEIIRKKAEDAGLTVSAYIRSAALNTRVNSRIDDKFLKELMRL
GRMQKHLFVEGKRTGDKEYASVLVAITELSNTVRKKLMEN

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP

ID   3430 GenBank   WP_114047645
Name   trbC_CHD70_RS27330_pSA20083530.1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86727.96 Da        Isoelectric Point: 7.4501

>WP_114047645.1 F-type conjugative transfer protein TrbC [Salmonella enterica]
MSEHRVNPELIHRAAWGNPLWNALQTLNIYGLCLAGSLVVSFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLKYADPSQDRMIKRSLFSFWPTLFQYEVIKESPANGIFYVGYQRVRDIGRELWLNIDDLTRHIM
FFATTGGGKTETIFAWAINPLCWGRGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTETFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFVTQQSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNSLQRQDGIFGESWIDSPQISILMESKINVQELIELH
AGEFFSIFRGDTVPSASFLIPDGEKSCSSDPVVINRYISVDAPHLDCLRRLVPRTAQRRIPSPENVSAIT
GVLTAKPSRKRRKIRTELHTIVDTFQQRIAGRQAAMAMLEEYDTDINARERALWETAVNTLKTTTREERR
IRYITLNRPDTPATEEENQISVRTERAGINLLALPKDNKHPAGRPVSGLHHKKNRRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 81091..119367

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CHD70_RS27315 (CHD70_27325) 76385..76762 - 378 WP_114047642 RidA family protein -
CHD70_RS27320 (CHD70_27330) 76785..77744 - 960 WP_114047643 sugar phosphate isomerase/epimerase family protein -
CHD70_RS27325 (CHD70_27335) 77930..78613 + 684 WP_114047644 PAS domain-containing protein -
CHD70_RS27330 (CHD70_27340) 78807..81098 - 2292 WP_114047645 F-type conjugative transfer protein TrbC -
CHD70_RS27335 (CHD70_27345) 81091..82161 - 1071 WP_114047646 DsbC family protein trbB
CHD70_RS27340 (CHD70_27350) 82180..83388 - 1209 WP_114047647 IncI1-type conjugal transfer protein TrbA trbA
CHD70_RS27345 (CHD70_27355) 83536..83880 + 345 WP_080102217 toxin -
CHD70_RS27350 (CHD70_27360) 83873..84187 + 315 WP_114047648 type II toxin-antitoxin system MqsA family antitoxin -
CHD70_RS27355 (CHD70_27365) 84301..85610 - 1310 Protein_100 IS3 family transposase -
CHD70_RS27360 (CHD70_27370) 85644..85778 - 135 Protein_101 Hha/YmoA family nucleoid-associated regulatory protein -
CHD70_RS27365 (CHD70_27375) 86008..86655 - 648 WP_205318806 plasmid IncI1-type surface exclusion protein ExcA -
CHD70_RS27370 (CHD70_27380) 86735..87040 - 306 Protein_103 hypothetical protein -
CHD70_RS27375 (CHD70_27385) 87060..88091 - 1032 WP_114046824 IS630 family transposase -
CHD70_RS27380 (CHD70_27390) 88192..90060 - 1869 Protein_105 DotA/TraY family protein -
CHD70_RS27385 (CHD70_27395) 90159..90743 - 585 WP_114047651 conjugal transfer protein TraX -
CHD70_RS27395 (CHD70_27405) 90984..92186 - 1203 WP_114047653 conjugal transfer protein TraW traW
CHD70_RS27400 (CHD70_27410) 92144..92773 - 630 WP_114047654 conjugal transfer protein TraV -
CHD70_RS27405 (CHD70_27415) 92773..95817 - 3045 WP_114047655 ATP-binding protein traU
CHD70_RS27410 (CHD70_27420) 95915..96715 - 801 WP_114047656 conjugal transfer protein TraT traT
CHD70_RS27415 (CHD70_27425) 96699..96887 - 189 WP_000556965 hypothetical protein -
CHD70_RS27420 (CHD70_27430) 96956..97360 - 405 WP_080102228 DUF6750 family protein traR
CHD70_RS27425 (CHD70_27435) 97403..97930 - 528 WP_080102229 conjugal transfer protein TraQ traQ
CHD70_RS27430 (CHD70_27440) 97930..98643 - 714 WP_114047657 conjugal transfer protein TraP traP
CHD70_RS27435 (CHD70_27445) 98640..99941 - 1302 WP_114047658 conjugal transfer protein TraO traO
CHD70_RS27440 (CHD70_27450) 99944..100927 - 984 WP_114047659 DotH/IcmK family type IV secretion protein traN
CHD70_RS27445 (CHD70_27455) 100943..101566 - 624 WP_080102285 DotI/IcmL family type IV secretion protein traM
CHD70_RS27450 (CHD70_27460) 101641..101991 - 351 WP_080102233 conjugal transfer protein traL
CHD70_RS27455 (CHD70_27465) 102009..105560 - 3552 WP_114047660 LPD7 domain-containing protein -
CHD70_RS27460 (CHD70_27470) 105840..106397 - 558 WP_114047661 phospholipase D family protein -
CHD70_RS29205 (CHD70_27475) 106412..106702 - 291 WP_001838506 hypothetical protein traK
CHD70_RS27470 (CHD70_27480) 106699..107847 - 1149 WP_114047662 plasmid transfer ATPase TraJ virB11
CHD70_RS27475 (CHD70_27485) 107991..108824 - 834 WP_080102237 type IV secretory system conjugative DNA transfer family protein traI
CHD70_RS27480 (CHD70_27490) 108821..109276 - 456 WP_114047663 DotD/TraH family lipoprotein -
CHD70_RS27485 (CHD70_27495) 109797..110999 - 1203 WP_080102240 conjugal transfer protein TraF -
CHD70_RS27490 (CHD70_27500) 111086..111910 - 825 WP_114047664 conjugal transfer protein TraE traE
CHD70_RS27495 (CHD70_27505) 112061..113215 - 1155 WP_114047665 site-specific integrase -
CHD70_RS29210 (CHD70_27510) 113267..113524 + 258 Protein_128 Shufflon protein B -
CHD70_RS27505 (CHD70_27515) 113521..114870 - 1350 WP_240198389 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CHD70_RS27510 (CHD70_27520) 114858..115514 - 657 WP_114047666 A24 family peptidase -
CHD70_RS27515 (CHD70_27525) 115499..116059 - 561 WP_114047667 lytic transglycosylase domain-containing protein virB1
CHD70_RS27520 (CHD70_27530) 116069..116686 - 618 WP_114047668 type 4 pilus major pilin -
CHD70_RS27525 (CHD70_27535) 116704..117801 - 1098 WP_114047669 type II secretion system F family protein -
CHD70_RS27530 (CHD70_27540) 117814..119367 - 1554 WP_080102248 ATPase, T2SS/T4P/T4SS family virB11
CHD70_RS27535 (CHD70_27545) 119378..119830 - 453 WP_114047670 type IV pilus biogenesis protein PilP -
CHD70_RS27540 (CHD70_27550) 119817..121118 - 1302 WP_114047671 type 4b pilus protein PilO2 -
CHD70_RS27545 (CHD70_27555) 121111..122793 - 1683 WP_114047672 PilN family type IVB pilus formation outer membrane protein -
CHD70_RS27550 (CHD70_27560) 122807..123244 - 438 WP_080102252 type IV pilus biogenesis protein PilM -
CHD70_RS27555 (CHD70_27565) 123244..124311 - 1068 WP_114047673 TcpQ domain-containing protein -

Host bacterium

ID   5395 GenBank   NZ_CP030204
Plasmid name   pSA20083530.1 Incompatibility group   IncB/O/K/Z
Plasmid size   138648 bp Coordinate of oriT [Strand]   71842..71923 [-]
Host baterium   Salmonella enterica strain SA20083530

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -