Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104953
Name   oriT_pSA20104250.1 in_silico
Organism   Salmonella enterica strain SA20104250
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP030191 (53437..53525 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pSA20104250.1
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3481 GenBank   WP_069924919
Name   nikB_CHE86_RS24885_pSA20104250.1 insolico UniProt ID   _
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103995.33 Da        Isoelectric Point: 7.3426

>WP_069924919.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPVLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRASVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure



No available structure.




Auxiliary protein

ID   1548 GenBank   WP_001283947
Name   WP_001283947_pSA20104250.1 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   3427 GenBank   WP_001289276
Name   trbC_CHE86_RS24890_pSA20104250.1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 58903..100035

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CHE86_RS24890 (CHE86_24890) 56619..58910 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
CHE86_RS24895 (CHE86_24895) 58903..59973 - 1071 WP_046340328 IncI1-type conjugal transfer protein TrbB trbB
CHE86_RS24900 (CHE86_24900) 59992..61200 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
CHE86_RS24905 (CHE86_24905) 61507..62286 - 780 WP_275450201 protein FinQ -
CHE86_RS24910 (CHE86_24910) 62913..63065 + 153 WP_001303307 Hok/Gef family protein -
CHE86_RS24915 (CHE86_24915) 63137..63388 - 252 WP_001291965 hypothetical protein -
CHE86_RS25525 64312..64488 - 177 WP_001054900 hypothetical protein -
CHE86_RS24930 (CHE86_24930) 64697..64906 - 210 WP_001140545 hemolysin expression modulator Hha -
CHE86_RS24935 (CHE86_24935) 65004..65618 - 615 WP_000578649 plasmid IncI1-type surface exclusion protein ExcA -
CHE86_RS24940 (CHE86_24940) 65694..67862 - 2169 WP_000698360 IncI1-type conjugal transfer membrane protein TraY traY
CHE86_RS24945 (CHE86_24945) 67959..68543 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
CHE86_RS24950 (CHE86_24950) 68572..69774 - 1203 WP_001189159 IncI1-type conjugal transfer protein TraW traW
CHE86_RS24955 (CHE86_24955) 69741..70355 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
CHE86_RS24960 (CHE86_24960) 70355..73399 - 3045 WP_001024752 IncI1-type conjugal transfer protein TraU traU
CHE86_RS24965 (CHE86_24965) 73489..74289 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
CHE86_RS24970 (CHE86_24970) 74273..74461 - 189 WP_001277255 putative conjugal transfer protein TraS -
CHE86_RS24975 (CHE86_24975) 74525..74929 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
CHE86_RS24980 (CHE86_24980) 74980..75507 - 528 WP_001055569 conjugal transfer protein TraQ traQ
CHE86_RS24985 (CHE86_24985) 75507..76211 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
CHE86_RS24990 (CHE86_24990) 76211..77500 - 1290 WP_001271997 conjugal transfer protein TraO traO
CHE86_RS24995 (CHE86_24995) 77503..78486 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
CHE86_RS25000 (CHE86_25000) 78497..79189 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
CHE86_RS25005 (CHE86_25005) 79186..79533 - 348 WP_001055900 conjugal transfer protein traL
CHE86_RS25010 (CHE86_25010) 79551..83318 - 3768 WP_001141534 LPD7 domain-containing protein -
CHE86_RS25015 (CHE86_25015) 83408..83959 - 552 WP_000014584 phospholipase D family protein -
CHE86_RS25020 (CHE86_25020) 83974..84264 - 291 WP_001299214 hypothetical protein traK
CHE86_RS25025 (CHE86_25025) 84261..85409 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
CHE86_RS25030 (CHE86_25030) 85406..86224 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
CHE86_RS25035 (CHE86_25035) 86221..86679 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
CHE86_RS25040 (CHE86_25040) 87074..87619 - 546 Protein_93 lipopolysaccharide core heptose(II)-phosphate phosphatase -
CHE86_RS25045 (CHE86_25045) 87624..88852 + 1229 WP_089541817 IS3 family transposase -
CHE86_RS25870 88863..88994 - 132 Protein_95 histidine phosphatase family protein -
CHE86_RS25050 (CHE86_25050) 89054..90256 - 1203 WP_000976353 conjugal transfer protein TraF -
CHE86_RS25055 (CHE86_25055) 90342..91166 - 825 WP_001238927 conjugal transfer protein TraE traE
CHE86_RS25060 (CHE86_25060) 91317..92471 - 1155 WP_001139957 site-specific integrase -
CHE86_RS25095 (CHE86_25095) 93992..94240 + 249 WP_001349157 hypothetical protein -
CHE86_RS25100 (CHE86_25100) 94237..95529 - 1293 WP_001417545 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CHE86_RS25105 (CHE86_25105) 95529..96185 - 657 WP_001193553 prepilin peptidase -
CHE86_RS25110 (CHE86_25110) 96170..96730 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
CHE86_RS25115 (CHE86_25115) 96740..97354 - 615 WP_000959785 type 4 pilus major pilin -
CHE86_RS25120 (CHE86_25120) 97372..98469 - 1098 WP_001208805 type II secretion system F family protein -
CHE86_RS25125 (CHE86_25125) 98482..100035 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
CHE86_RS25130 (CHE86_25130) 100046..100498 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
CHE86_RS25135 (CHE86_25135) 100485..101780 - 1296 WP_000752774 type 4b pilus protein PilO2 -
CHE86_RS25140 (CHE86_25140) 101773..103455 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
CHE86_RS25145 (CHE86_25145) 103469..103906 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
CHE86_RS25150 (CHE86_25150) 103906..104973 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   5391 GenBank   NZ_CP030191
Plasmid name   pSA20104250.1 Incompatibility group   IncI1
Plasmid size   111887 bp Coordinate of oriT [Strand]   53437..53525 [-]
Host baterium   Salmonella enterica strain SA20104250

Cargo genes

Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2