Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104950
Name   oriT_pSA20101045.1 in_silico
Organism   Salmonella enterica strain SA20101045
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP030234 (38428..38516 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pSA20101045.1
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3479 GenBank   WP_010891268
Name   nikB_CHE40_RS24405_pSA20101045.1 insolico UniProt ID   A0A632VGA6
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103977.42 Da        Isoelectric Point: 7.2753

>WP_010891268.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYIAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFLQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A632VGA6


Auxiliary protein


ID   1547 GenBank   WP_001283947
Name   WP_001283947_pSA20101045.1 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP


ID   3425 GenBank   WP_001289276
Name   trbC_CHE40_RS24410_pSA20101045.1 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86941.11 Da        Isoelectric Point: 6.7713

>WP_001289276.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 43894..85047

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CHE40_RS24410 (CHE40_24405) 41610..43901 - 2292 WP_001289276 F-type conjugative transfer protein TrbC -
CHE40_RS24415 (CHE40_24410) 43894..44964 - 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
CHE40_RS24420 (CHE40_24415) 44983..46191 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
CHE40_RS24425 (CHE40_24420) 46483..46635 + 153 WP_001303307 Hok/Gef family protein -
CHE40_RS24430 (CHE40_24425) 46707..46958 - 252 WP_001291965 hypothetical protein -
CHE40_RS24965 47882..48058 - 177 WP_001054900 hypothetical protein -
CHE40_RS24445 (CHE40_24440) 48450..48659 + 210 WP_000062603 HEAT repeat domain-containing protein -
CHE40_RS24450 (CHE40_24445) 48731..49393 - 663 WP_000644794 plasmid IncI1-type surface exclusion protein ExcA -
CHE40_RS24455 (CHE40_24450) 49464..51632 - 2169 WP_000698368 DotA/TraY family protein traY
CHE40_RS24460 (CHE40_24455) 51729..52313 - 585 WP_001037998 conjugal transfer protein TraX -
CHE40_RS24465 (CHE40_24460) 52342..53544 - 1203 WP_001697941 IncI1-type conjugal transfer protein TraW traW
CHE40_RS24470 (CHE40_24465) 53511..54125 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
CHE40_RS24475 (CHE40_24470) 54125..57169 - 3045 WP_010891269 IncI1-type conjugal transfer protein TraU traU
CHE40_RS24480 (CHE40_24475) 57259..58059 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
CHE40_RS24485 (CHE40_24480) 58043..58231 - 189 WP_001277255 putative conjugal transfer protein TraS -
CHE40_RS24490 (CHE40_24485) 58295..58699 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
CHE40_RS24495 (CHE40_24490) 58750..59277 - 528 WP_001055569 conjugal transfer protein TraQ traQ
CHE40_RS24500 (CHE40_24495) 59277..59981 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
CHE40_RS24505 (CHE40_24500) 59981..61270 - 1290 WP_001271994 conjugal transfer protein TraO traO
CHE40_RS24510 (CHE40_24505) 61273..62256 - 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
CHE40_RS24515 (CHE40_24510) 62267..62959 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
CHE40_RS24520 (CHE40_24515) 62956..63303 - 348 WP_001055900 conjugal transfer protein traL
CHE40_RS24525 (CHE40_24520) 63321..67088 - 3768 WP_010891270 LPD7 domain-containing protein -
CHE40_RS24530 (CHE40_24525) 67178..67729 - 552 WP_000014584 phospholipase D family protein -
CHE40_RS24535 (CHE40_24530) 67744..68034 - 291 WP_001299214 hypothetical protein traK
CHE40_RS24540 (CHE40_24535) 68031..69179 - 1149 WP_052979471 plasmid transfer ATPase TraJ virB11
CHE40_RS24545 (CHE40_24540) 69176..69994 - 819 WP_000646095 IncI1-type conjugal transfer lipoprotein TraI traI
CHE40_RS24550 (CHE40_24545) 69991..70449 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
CHE40_RS24555 (CHE40_24550) 70844..71428 - 585 WP_000977522 histidine phosphatase family protein -
CHE40_RS24560 (CHE40_24555) 71488..72690 - 1203 WP_000976353 conjugal transfer protein TraF -
CHE40_RS24570 (CHE40_24565) 72842..73480 + 639 WP_161477592 IS4 family transposase -
CHE40_RS24575 (CHE40_24570) 73365..74503 - 1139 Protein_83 IS3-like element ISEc52 family transposase -
CHE40_RS24580 (CHE40_24575) 74563..75303 + 741 Protein_84 IS4-like element ISVsa5 family transposase -
CHE40_RS24585 (CHE40_24580) 75367..76191 - 825 WP_114051253 conjugal transfer protein TraE traE
CHE40_RS24590 (CHE40_24585) 76342..77496 - 1155 WP_001139958 site-specific integrase -
CHE40_RS25355 77495..77848 + 354 WP_001393368 hypothetical protein -
CHE40_RS25535 (CHE40_24620) 78912..79133 + 222 Protein_88 prepilin -
CHE40_RS24630 (CHE40_24625) 79130..80566 - 1437 WP_000527428 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CHE40_RS24635 (CHE40_24630) 80554..81210 - 657 WP_001193549 A24 family peptidase -
CHE40_RS24640 (CHE40_24635) 81195..81755 - 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
CHE40_RS24645 (CHE40_24640) 81765..82379 - 615 WP_000908226 type 4 pilus major pilin -
CHE40_RS24650 (CHE40_24645) 82396..83481 - 1086 WP_001208802 type II secretion system F family protein -
CHE40_RS24655 (CHE40_24650) 83494..85047 - 1554 WP_000362206 ATPase, T2SS/T4P/T4SS family virB11
CHE40_RS24660 (CHE40_24655) 85058..85510 - 453 WP_001247337 type IV pilus biogenesis protein PilP -
CHE40_RS24665 (CHE40_24660) 85497..86792 - 1296 WP_000752780 type 4b pilus protein PilO2 -
CHE40_RS24670 (CHE40_24665) 86785..88467 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
CHE40_RS24675 (CHE40_24670) 88481..88918 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
CHE40_RS24680 (CHE40_24675) 88918..89985 - 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   5388 GenBank   NZ_CP030234
Plasmid name   pSA20101045.1 Incompatibility group   IncI1
Plasmid size   94810 bp Coordinate of oriT [Strand]   38428..38516 [-]
Host baterium   Salmonella enterica strain SA20101045

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -