Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104932
Name   oriT_2020CK-00213|unnamed in_silico
Organism   Klebsiella oxytoca strain 2020CK-00213
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP118217 (2411..2470 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_2020CK-00213|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3473 GenBank   WP_275880961
Name   Relaxase_PVK22_RS31020_2020CK-00213|unnamed insolico UniProt ID   _
Length   167 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 167 a.a.        Molecular weight: 18818.47 Da        Isoelectric Point: 9.2615

>WP_275880961.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella oxytoca]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHEDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALITPSGLPKTT

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(57-156)


  Protein structure



No available structure.




Auxiliary protein

ID   1541 GenBank   WP_021243036
Name   WP_021243036_2020CK-00213|unnamed insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11899.67 Da        Isoelectric Point: 8.5732

>WP_021243036.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCDGRQLAAWMRQTCLDEKPARTGKLPSISPALLRQLAGMGNNLNQIARRVNAG
GGTGHDRVQIVAALMAIDAGLERLRHAVLEKGTDDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   5370 GenBank   NZ_CP118217
Plasmid name   2020CK-00213|unnamed Incompatibility group   Col440I
Plasmid size   3395 bp Coordinate of oriT [Strand]   2411..2470 [-]
Host baterium   Klebsiella oxytoca strain 2020CK-00213

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -