Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104859 |
| Name | oriT_pKPN20-1  |
| Organism | Klebsiella pneumoniae strain KPN20 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP092337 (169904..169953 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKPN20-1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3381 | GenBank | WP_015065541 |
| Name | traD_MG291_RS26495_pKPN20-1 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 86025.00 Da Isoelectric Point: 5.0577
>WP_015065541.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 139045..170511
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MG291_RS26490 (MG291_26490) | 136649..139045 | - | 2397 | Protein_162 | MobF family relaxase | - |
| MG291_RS26495 (MG291_26495) | 139045..141357 | - | 2313 | WP_015065541 | type IV conjugative transfer system coupling protein TraD | virb4 |
| MG291_RS26500 (MG291_26500) | 141486..142175 | - | 690 | WP_015065540 | hypothetical protein | - |
| MG291_RS26505 (MG291_26505) | 142367..143098 | - | 732 | WP_032329926 | conjugal transfer complement resistance protein TraT | - |
| MG291_RS26510 (MG291_26510) | 143407..143931 | - | 525 | WP_015065538 | hypothetical protein | - |
| MG291_RS26515 (MG291_26515) | 143942..146785 | - | 2844 | WP_126834914 | conjugal transfer mating-pair stabilization protein TraG | traG |
| MG291_RS26520 (MG291_26520) | 146785..148155 | - | 1371 | WP_109043160 | conjugal transfer pilus assembly protein TraH | traH |
| MG291_RS26525 (MG291_26525) | 148142..148570 | - | 429 | WP_015065560 | hypothetical protein | - |
| MG291_RS26530 (MG291_26530) | 148563..149135 | - | 573 | WP_023292147 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| MG291_RS26535 (MG291_26535) | 149107..149346 | - | 240 | WP_004152687 | type-F conjugative transfer system pilin chaperone TraQ | - |
| MG291_RS26540 (MG291_26540) | 149357..150109 | - | 753 | WP_020803149 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| MG291_RS26545 (MG291_26545) | 150130..150456 | - | 327 | WP_004144402 | hypothetical protein | - |
| MG291_RS26550 (MG291_26550) | 150469..150717 | - | 249 | WP_004152675 | hypothetical protein | - |
| MG291_RS26555 (MG291_26555) | 150695..150949 | - | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| MG291_RS26560 (MG291_26560) | 150981..152936 | - | 1956 | WP_126834915 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| MG291_RS26565 (MG291_26565) | 152995..153642 | - | 648 | WP_042946323 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| MG291_RS26570 (MG291_26570) | 153787..154389 | - | 603 | WP_022631520 | hypothetical protein | - |
| MG291_RS26575 (MG291_26575) | 154446..155135 | + | 690 | WP_126834916 | hypothetical protein | - |
| MG291_RS26580 (MG291_26580) | 155110..155658 | - | 549 | WP_022631518 | hypothetical protein | - |
| MG291_RS26585 (MG291_26585) | 155673..156656 | - | 984 | WP_223176982 | conjugal transfer pilus assembly protein TraU | traU |
| MG291_RS26590 (MG291_26590) | 156676..157302 | - | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| MG291_RS26595 (MG291_26595) | 157302..157691 | - | 390 | WP_126834917 | type-F conjugative transfer system protein TrbI | - |
| MG291_RS26600 (MG291_26600) | 157691..160330 | - | 2640 | WP_126834918 | type IV secretion system protein TraC | virb4 |
| MG291_RS26605 (MG291_26605) | 160402..160800 | - | 399 | WP_162847633 | hypothetical protein | - |
| MG291_RS26610 (MG291_26610) | 160808..161098 | - | 291 | WP_064291689 | hypothetical protein | - |
| MG291_RS26615 (MG291_26615) | 161095..161499 | - | 405 | WP_126834919 | hypothetical protein | - |
| MG291_RS26620 (MG291_26620) | 161566..161883 | - | 318 | WP_023320103 | hypothetical protein | - |
| MG291_RS26625 (MG291_26625) | 161884..162102 | - | 219 | WP_004171484 | hypothetical protein | - |
| MG291_RS26630 (MG291_26630) | 162126..162416 | - | 291 | WP_114266782 | hypothetical protein | - |
| MG291_RS26635 (MG291_26635) | 162421..162831 | - | 411 | WP_064291693 | hypothetical protein | - |
| MG291_RS26640 (MG291_26640) | 162963..163547 | - | 585 | WP_126834920 | type IV conjugative transfer system lipoprotein TraV | traV |
| MG291_RS26645 (MG291_26645) | 163570..163803 | - | 234 | WP_223825638 | hypothetical protein | - |
| MG291_RS26650 (MG291_26650) | 163784..164371 | - | 588 | WP_307774117 | conjugal transfer protein TraP | - |
| MG291_RS26655 (MG291_26655) | 164364..165788 | - | 1425 | WP_126834921 | F-type conjugal transfer pilus assembly protein TraB | traB |
| MG291_RS26660 (MG291_26660) | 165788..166528 | - | 741 | WP_126834922 | type-F conjugative transfer system secretin TraK | traK |
| MG291_RS26665 (MG291_26665) | 166515..167081 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| MG291_RS26670 (MG291_26670) | 167101..167406 | - | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| MG291_RS26675 (MG291_26675) | 167420..167788 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| MG291_RS26680 (MG291_26680) | 167842..168213 | - | 372 | WP_004208838 | TraY domain-containing protein | - |
| MG291_RS26685 (MG291_26685) | 168297..168992 | - | 696 | WP_126834923 | transcriptional regulator TraJ family protein | - |
| MG291_RS26690 (MG291_26690) | 169199..169591 | - | 393 | WP_032441878 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| MG291_RS26695 (MG291_26695) | 170026..170511 | + | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| MG291_RS26700 (MG291_26700) | 170544..170873 | - | 330 | WP_032420969 | DUF5983 family protein | - |
| MG291_RS26705 (MG291_26705) | 170906..171727 | - | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| MG291_RS26710 (MG291_26710) | 172557..172970 | - | 414 | WP_023287139 | helix-turn-helix domain-containing protein | - |
| MG291_RS26715 (MG291_26715) | 172971..173249 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| MG291_RS26720 (MG291_26720) | 173239..173559 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MG291_RS26725 (MG291_26725) | 173640..173864 | - | 225 | WP_014343499 | hypothetical protein | - |
| MG291_RS26730 (MG291_26730) | 173875..174087 | - | 213 | WP_019706020 | hypothetical protein | - |
| MG291_RS26735 (MG291_26735) | 174148..174504 | - | 357 | WP_019706019 | hypothetical protein | - |
| MG291_RS26740 (MG291_26740) | 175133..175483 | - | 351 | WP_004152758 | hypothetical protein | - |
Host bacterium
| ID | 5297 | GenBank | NZ_CP092337 |
| Plasmid name | pKPN20-1 | Incompatibility group | IncFIB |
| Plasmid size | 212639 bp | Coordinate of oriT [Strand] | 169904..169953 [+] |
| Host baterium | Klebsiella pneumoniae strain KPN20 |
Cargo genes
| Drug resistance gene | sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaCTX-M-15, dfrA14, qnrB1, ARR-3, rmtF |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |