Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104827 |
| Name | oriT_CriePir197|unnamed1  |
| Organism | Klebsiella pneumoniae strain CriePir197 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP062998 (60200..60249 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_CriePir197|unnamed1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3363 | GenBank | WP_013214038 |
| Name | traD_GJJ12_RS26095_CriePir197|unnamed1 |
UniProt ID | _ |
| Length | 770 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 86010.07 Da Isoelectric Point: 5.1787
>WP_013214038.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 29419..60807
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GJJ12_RS26095 (GJJ12_026095) | 29419..31731 | - | 2313 | WP_013214038 | type IV conjugative transfer system coupling protein TraD | virb4 |
| GJJ12_RS26100 (GJJ12_026100) | 31858..32547 | - | 690 | WP_013023831 | hypothetical protein | - |
| GJJ12_RS26105 (GJJ12_026105) | 32740..33174 | - | 435 | Protein_35 | complement resistance protein TraT | - |
| GJJ12_RS26110 (GJJ12_026110) | 33189..34157 | + | 969 | WP_077254959 | IS5-like element IS903B family transposase | - |
| GJJ12_RS26115 (GJJ12_026115) | 34476..35501 | - | 1026 | WP_001101446 | IS110 family transposase | - |
| GJJ12_RS26120 (GJJ12_026120) | 35588..35909 | - | 322 | Protein_38 | complement resistance protein TraT | - |
| GJJ12_RS26130 (GJJ12_026130) | 36098..36625 | - | 528 | WP_032409657 | conjugal transfer protein TraS | - |
| GJJ12_RS26135 (GJJ12_026135) | 36631..39480 | - | 2850 | WP_023287129 | conjugal transfer mating-pair stabilization protein TraG | traG |
| GJJ12_RS26140 (GJJ12_026140) | 39480..40859 | - | 1380 | WP_074192363 | conjugal transfer pilus assembly protein TraH | traH |
| GJJ12_RS26145 (GJJ12_026145) | 40837..41280 | - | 444 | WP_023287131 | F-type conjugal transfer protein TrbF | - |
| GJJ12_RS26150 (GJJ12_026150) | 41326..41883 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| GJJ12_RS26155 (GJJ12_026155) | 41855..42094 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| GJJ12_RS26160 (GJJ12_026160) | 42105..42857 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| GJJ12_RS26165 (GJJ12_026165) | 42878..43204 | - | 327 | WP_004152676 | hypothetical protein | - |
| GJJ12_RS26170 (GJJ12_026170) | 43217..43465 | - | 249 | WP_004152675 | hypothetical protein | - |
| GJJ12_RS26175 (GJJ12_026175) | 43443..43697 | - | 255 | WP_023287133 | conjugal transfer protein TrbE | - |
| GJJ12_RS26180 (GJJ12_026180) | 43729..45684 | - | 1956 | WP_046041928 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| GJJ12_RS26185 (GJJ12_026185) | 45743..46381 | - | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| GJJ12_RS26190 (GJJ12_026190) | 46394..47383 | - | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
| GJJ12_RS26195 (GJJ12_026195) | 47380..47769 | - | 390 | WP_042922355 | hypothetical protein | - |
| GJJ12_RS26200 (GJJ12_026200) | 47811..48437 | - | 627 | WP_009309871 | type-F conjugative transfer system protein TraW | traW |
| GJJ12_RS26205 (GJJ12_026205) | 48437..48826 | - | 390 | WP_049245998 | type-F conjugative transfer system protein TrbI | - |
| GJJ12_RS26210 (GJJ12_026210) | 48826..51465 | - | 2640 | WP_032431388 | type IV secretion system protein TraC | virb4 |
| GJJ12_RS26215 (GJJ12_026215) | 51537..51935 | - | 399 | WP_023179972 | hypothetical protein | - |
| GJJ12_RS26220 (GJJ12_026220) | 52313..52717 | - | 405 | WP_004197817 | hypothetical protein | - |
| GJJ12_RS26225 (GJJ12_026225) | 52784..53095 | - | 312 | WP_004195240 | hypothetical protein | - |
| GJJ12_RS26230 (GJJ12_026230) | 53096..53314 | - | 219 | WP_004195235 | hypothetical protein | - |
| GJJ12_RS26235 (GJJ12_026235) | 53420..53830 | - | 411 | WP_004152499 | hypothetical protein | - |
| GJJ12_RS26240 (GJJ12_026240) | 53962..54546 | - | 585 | WP_032441881 | type IV conjugative transfer system lipoprotein TraV | traV |
| GJJ12_RS26245 (GJJ12_026245) | 54660..56084 | - | 1425 | WP_042922367 | F-type conjugal transfer pilus assembly protein TraB | traB |
| GJJ12_RS26250 (GJJ12_026250) | 56084..56824 | - | 741 | WP_015065528 | type-F conjugative transfer system secretin TraK | traK |
| GJJ12_RS26255 (GJJ12_026255) | 56811..57377 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| GJJ12_RS26260 (GJJ12_026260) | 57397..57702 | - | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| GJJ12_RS26265 (GJJ12_026265) | 57716..58084 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| GJJ12_RS26270 (GJJ12_026270) | 58138..58509 | - | 372 | WP_004208838 | TraY domain-containing protein | - |
| GJJ12_RS26275 (GJJ12_026275) | 58593..59279 | - | 687 | WP_071561590 | transcriptional regulator TraJ family protein | - |
| GJJ12_RS26280 (GJJ12_026280) | 59495..59887 | - | 393 | WP_032441878 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| GJJ12_RS26285 (GJJ12_026285) | 60322..60807 | + | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| GJJ12_RS26290 (GJJ12_026290) | 60840..61169 | - | 330 | WP_011977736 | DUF5983 family protein | - |
| GJJ12_RS26295 (GJJ12_026295) | 61202..62023 | - | 822 | WP_153928355 | DUF932 domain-containing protein | - |
| GJJ12_RS26300 (GJJ12_026300) | 62851..63264 | - | 414 | WP_021312979 | helix-turn-helix domain-containing protein | - |
| GJJ12_RS26305 (GJJ12_026305) | 63265..63543 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| GJJ12_RS26310 (GJJ12_026310) | 63533..63853 | - | 321 | WP_064179540 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| GJJ12_RS26315 (GJJ12_026315) | 63934..64158 | - | 225 | WP_014343499 | hypothetical protein | - |
| GJJ12_RS26320 (GJJ12_026320) | 64169..64381 | - | 213 | WP_019706020 | hypothetical protein | - |
| GJJ12_RS26325 (GJJ12_026325) | 64442..64798 | - | 357 | WP_019706019 | hypothetical protein | - |
Host bacterium
| ID | 5265 | GenBank | NZ_CP062998 |
| Plasmid name | CriePir197|unnamed1 | Incompatibility group | IncFIB |
| Plasmid size | 114497 bp | Coordinate of oriT [Strand] | 60200..60249 [+] |
| Host baterium | Klebsiella pneumoniae strain CriePir197 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | ncrA, ncrB, ncrC, ncrY |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |