Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104771
Name   oriT_pPIR00503 in_silico
Organism   Salmonella enterica subsp. enterica serovar Hadar strain PIR00503
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CM010228 (76164..76252 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_pPIR00503
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3393 GenBank   WP_059277931
Name   nikB_C0V85_RS00585_pPIR00503 insolico UniProt ID   _
Length   900 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 900 a.a.        Molecular weight: 104220.79 Da        Isoelectric Point: 7.5238

>WP_059277931.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPKMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKLWEPPSPMR

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure



No available structure.




Auxiliary protein

ID   1509 GenBank   WP_001283947
Name   WP_001283947_pPIR00503 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP

ID   3331 GenBank   WP_024168876
Name   trbC_C0V85_RS00595_pPIR00503 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86927.04 Da        Isoelectric Point: 6.6402

>WP_024168876.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTAQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETNEENQISVRAERASINLLTLPQDNNHPTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2547..16722

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C0V85_RS25135 3..1895 - 1893 Protein_0 DUF5710 domain-containing protein -
C0V85_RS00015 (C0V85_24015) 1984..2532 - 549 WP_112298088 phospholipase D family protein -
C0V85_RS00020 (C0V85_24020) 2547..2837 - 291 WP_001299214 hypothetical protein traK
C0V85_RS00025 (C0V85_24025) 2834..3982 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
C0V85_RS00030 (C0V85_24030) 3979..4797 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
C0V85_RS00035 (C0V85_24035) 4794..5252 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
C0V85_RS00040 (C0V85_24040) 5647..6231 - 585 WP_000977522 histidine phosphatase family protein -
C0V85_RS00045 (C0V85_24045) 6291..7493 - 1203 WP_000976351 conjugal transfer protein TraF -
C0V85_RS00050 (C0V85_24050) 7578..8402 - 825 WP_001238939 conjugal transfer protein TraE traE
C0V85_RS00055 (C0V85_24055) 8553..9707 - 1155 WP_001139957 site-specific integrase -
C0V85_RS00085 (C0V85_24085) 10864..12216 - 1353 WP_258521920 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C0V85_RS00090 (C0V85_24090) 12216..12872 - 657 WP_001193553 prepilin peptidase -
C0V85_RS00095 (C0V85_24095) 12857..13417 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
C0V85_RS00100 (C0V85_24100) 13427..14041 - 615 WP_000959785 type 4 pilus major pilin -
C0V85_RS00105 (C0V85_24105) 14059..15156 - 1098 WP_112298089 type II secretion system F family protein -
C0V85_RS00110 (C0V85_24110) 15169..16722 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
C0V85_RS00115 (C0V85_24115) 16733..17185 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
C0V85_RS00120 (C0V85_24120) 17172..18467 - 1296 WP_000752774 type 4b pilus protein PilO2 -
C0V85_RS00125 (C0V85_24125) 18460..20142 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
C0V85_RS00130 (C0V85_24130) 20156..20593 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
C0V85_RS00135 (C0V85_24135) 20593..21660 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -

Region 2: 82610..120856

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C0V85_RS00590 (C0V85_24590) 79435..80253 + 819 WP_059277930 DUF2971 domain-containing protein -
C0V85_RS00595 (C0V85_24595) 80326..82617 - 2292 WP_024168876 F-type conjugative transfer protein TrbC -
C0V85_RS00600 (C0V85_24600) 82610..83680 - 1071 WP_059277929 IncI1-type conjugal transfer protein TrbB trbB
C0V85_RS00605 (C0V85_24605) 83699..84907 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
C0V85_RS00610 (C0V85_24610) 85199..85351 + 153 WP_001303307 Hok/Gef family protein -
C0V85_RS00615 (C0V85_24615) 85423..85674 - 252 WP_001291965 hypothetical protein -
C0V85_RS25480 86173..86268 + 96 WP_001303310 DinQ-like type I toxin DqlB -
C0V85_RS25025 86333..86509 - 177 WP_001054897 hypothetical protein -
C0V85_RS00620 (C0V85_24620) 86901..87110 + 210 WP_000062603 HEAT repeat domain-containing protein -
C0V85_RS00625 (C0V85_24625) 87182..87844 - 663 WP_000644796 plasmid IncI1-type surface exclusion protein ExcA -
C0V85_RS00630 (C0V85_24630) 87915..90083 - 2169 WP_000698354 DotA/TraY family protein traY
C0V85_RS00635 (C0V85_24635) 90180..90764 - 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
C0V85_RS00640 (C0V85_24640) 90793..91995 - 1203 WP_001385654 IncI1-type conjugal transfer protein TraW traW
C0V85_RS00645 (C0V85_24645) 91962..92576 - 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
C0V85_RS00650 (C0V85_24650) 92576..95620 - 3045 WP_001024780 IncI1-type conjugal transfer protein TraU traU
C0V85_RS00655 (C0V85_24655) 95710..96510 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
C0V85_RS00660 (C0V85_24660) 96494..96682 - 189 WP_001277255 putative conjugal transfer protein TraS -
C0V85_RS00665 (C0V85_24665) 96746..97150 - 405 WP_000086958 IncI1-type conjugal transfer protein TraR traR
C0V85_RS00670 (C0V85_24670) 97201..97728 - 528 WP_001055569 conjugal transfer protein TraQ traQ
C0V85_RS00675 (C0V85_24675) 97728..98432 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
C0V85_RS00680 (C0V85_24680) 98432..99721 - 1290 WP_001272003 conjugal transfer protein TraO traO
C0V85_RS00685 (C0V85_24685) 99724..100707 - 984 WP_001191877 IncI1-type conjugal transfer protein TraN traN
C0V85_RS00690 (C0V85_24690) 100718..101410 - 693 WP_000138550 DotI/IcmL family type IV secretion protein traM
C0V85_RS00695 (C0V85_24695) 101407..101754 - 348 WP_001055900 conjugal transfer protein traL
C0V85_RS00700 (C0V85_24700) 101772..105539 - 3768 WP_001141527 LPD7 domain-containing protein -
C0V85_RS00705 (C0V85_24705) 105629..106180 - 552 WP_000014583 phospholipase D family protein -
C0V85_RS00710 (C0V85_24710) 106195..106485 - 291 WP_001299214 hypothetical protein traK
C0V85_RS00715 (C0V85_24715) 106482..107630 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
C0V85_RS00720 (C0V85_24720) 107627..108445 - 819 WP_000646098 IncI1-type conjugal transfer lipoprotein TraI traI
C0V85_RS00725 (C0V85_24725) 108442..108900 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
C0V85_RS00730 (C0V85_24730) 109295..109879 - 585 WP_000977522 histidine phosphatase family protein -
C0V85_RS00735 (C0V85_24735) 109939..111141 - 1203 WP_000976351 conjugal transfer protein TraF -
C0V85_RS00740 (C0V85_24740) 111226..112050 - 825 WP_001238939 conjugal transfer protein TraE traE
C0V85_RS00745 (C0V85_24745) 112201..113355 - 1155 WP_001139957 site-specific integrase -
C0V85_RS00780 (C0V85_24780) 115063..116350 - 1288 Protein_127 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
C0V85_RS00785 (C0V85_24785) 116350..117006 - 657 WP_001193553 prepilin peptidase -
C0V85_RS00790 (C0V85_24790) 116991..117551 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
C0V85_RS00795 (C0V85_24795) 117561..118175 - 615 WP_000959785 type 4 pilus major pilin -
C0V85_RS00800 (C0V85_24800) 118193..119290 - 1098 WP_112298089 type II secretion system F family protein -
C0V85_RS00805 (C0V85_24805) 119303..120856 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
C0V85_RS00810 (C0V85_24810) 120867..121319 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
C0V85_RS00815 (C0V85_24815) 121306..122601 - 1296 Protein_134 type 4b pilus protein PilO2 -
C0V85_RS00820 (C0V85_24820) 122594..124279 - 1686 Protein_135 PilN family type IVB pilus formation outer membrane protein -
C0V85_RS25225 124293..124541 - 249 WP_343327360 type IV pilus biogenesis protein PilM -
C0V85_RS25230 124528..124731 - 204 WP_258521919 hypothetical protein -
C0V85_RS00830 (C0V85_24830) 124731..125135 - 405 Protein_138 type IV pilus biogenesis lipoprotein PilL -

Host bacterium

ID   5210 GenBank   NZ_CM010228
Plasmid name   pPIR00503 Incompatibility group   IncI1
Plasmid size   125136 bp Coordinate of oriT [Strand]   76164..76252 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Hadar strain PIR00503

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -