Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104767
Name   oriT_p2PIR00532 in_silico
Organism   Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP025558 (9968..10316 [-], 349 nt)
oriT length   349 nt
IRs (inverted repeats)      134..140, 154..160  (AAAATAT..ATATTTT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 349 nt

>oriT_p2PIR00532
ACTGCGATGCAGGATAGGGCAAACGCCGCAAAATGACGTCTCTGACGCCATTCCGCAACGTTTGCCCGATGACCTACAGTCGGTTCTTGTTGGAGAGTTTTATGAAATATTTGGTCAAAGAGTTTATTAACGAAAAATATACTAAGGCTGTTAATATTTTAAAGGATAACCTTAAAGAACACTATCATGTTTTTTATTGTGTGAGATTAAGTGAGATTCTTTTTCCTGCCAGTGAATATGGAACTGAACAGTTTTTTAGTGATTTTGAAAAGATAAACTCCATTTCATTACCTGTCTTAGTGTTTGATCTCAAAGAGGGTGTTCCTGTGATTGTCATTAGTCTTGATGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3392 GenBank   WP_012477147
Name   mobP1_C0Z07_RS00535_p2PIR00532 insolico UniProt ID   A0A418GM36
Length   388 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 388 a.a.        Molecular weight: 44444.96 Da        Isoelectric Point: 10.5368

>WP_012477147.1 MULTISPECIES: MobP1 family relaxase [Enterobacteriaceae]
MGVYVDKEYRVKRKSSENGRKSAFAHKVKNGGKNYSRNVQERINRKGASKEVVVKISGGAVTRQGIRNSI
DYMSRESELPVMSESGRVWMGAEILEAKEHMIDRANDPQHVMNDKGKENKKITQNIVFSPPVLAKVKPED
LLESVRKTMQKKYPNHRFVLGYHCDKKEHPHVHVVFRIRDNDGKRADIRKKDLREIRTGFCEELKLKGYD
VKATHKQQHGLNQSVKDAHNTAPKRQKGVYEVVDIGYDHYQNDKTKSKQHFIKLKTLNKGVEKTYWGADF
GDLCSRESVKAGDLVRLKKLGQKEVKIPALDKNGVQHGWKTVHRNEWQLENLGVKGVDRTPSASKELVLN
SPDMLLKQQQRMAQFTQQKASTLQSEQKLKTGIKFLGL

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(70-228)


  Protein structure


Source ID Structure
AlphaFold DB A0A418GM36


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 18598..28559

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
C0Z07_RS00495 (C0Z07_00500) 13915..14160 + 246 WP_000356542 hypothetical protein -
C0Z07_RS00500 (C0Z07_00505) 14150..14365 + 216 WP_001180117 hypothetical protein -
C0Z07_RS00505 (C0Z07_00510) 14458..14787 + 330 WP_000866654 hypothetical protein -
C0Z07_RS00510 (C0Z07_00515) 14829..15008 + 180 WP_000439079 hypothetical protein -
C0Z07_RS24675 (C0Z07_00520) 15078..15227 + 150 WP_000003880 hypothetical protein -
C0Z07_RS00520 (C0Z07_00525) 15240..15512 + 273 WP_000160399 hypothetical protein -
C0Z07_RS00530 (C0Z07_00535) 15838..16383 + 546 WP_020801480 DNA distortion polypeptide 1 -
C0Z07_RS00535 (C0Z07_00540) 16386..17552 + 1167 WP_012477147 MobP1 family relaxase -
C0Z07_RS00540 (C0Z07_00545) 17905..18423 + 519 WP_012301141 transcription termination/antitermination NusG family protein -
C0Z07_RS00545 (C0Z07_00550) 18353..18565 + 213 WP_000125172 hypothetical protein -
C0Z07_RS00550 (C0Z07_00555) 18598..19245 + 648 WP_012477148 lytic transglycosylase domain-containing protein virB1
C0Z07_RS00555 (C0Z07_00560) 19223..19519 + 297 WP_000916182 TrbC/VirB2 family protein virB2
C0Z07_RS00560 (C0Z07_00565) 19538..22291 + 2754 WP_012477149 VirB3 family type IV secretion system protein virb4
C0Z07_RS00565 (C0Z07_00570) 22302..23060 + 759 WP_000744200 type IV secretion system protein -
C0Z07_RS00570 (C0Z07_00575) 23061..23288 + 228 WP_000835348 EexN family lipoprotein -
C0Z07_RS00575 (C0Z07_00580) 23298..24431 + 1134 WP_012477150 type IV secretion system protein virB6
C0Z07_RS00580 (C0Z07_00585) 24677..25390 + 714 WP_000394612 type IV secretion system protein virB8
C0Z07_RS00585 (C0Z07_00590) 25395..26324 + 930 WP_000783372 TrbG/VirB9 family P-type conjugative transfer protein virB9
C0Z07_RS00590 (C0Z07_00595) 26321..27526 + 1206 WP_012477151 VirB10/TraB/TrbI family type IV secretion system protein virB10
C0Z07_RS00595 (C0Z07_00600) 27528..28559 + 1032 WP_001058474 P-type DNA transfer ATPase VirB11 virB11
C0Z07_RS00600 (C0Z07_00605) 28562..30097 + 1536 Protein_43 type IV secretory system conjugative DNA transfer family protein -

Host bacterium

ID   5206 GenBank   NZ_CP025558
Plasmid name   p2PIR00532 Incompatibility group   IncX1
Plasmid size   30098 bp Coordinate of oriT [Strand]   9968..10316 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Enteritidis strain PIR00532

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -