Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104762
Name   oriT_p19-10_01 in_silico
Organism   Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP023488 (14459..14507 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_p19-10_01
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1508 GenBank   WP_020805752
Name   WP_020805752_p19-10_01 insolico UniProt ID   A0A377TIM3
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14772.81 Da        Isoelectric Point: 4.5715

>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A377TIM3


T4CP

ID   3328 GenBank   WP_032454979
Name   traD_AN663_RS29065_p19-10_01 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 86062.11 Da        Isoelectric Point: 5.0175

>WP_032454979.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKRPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDEVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 107..15065

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AN663_RS27875 (AN663_27650) 107..745 - 639 WP_004193871 type-F conjugative transfer system pilin assembly protein TrbC trbC
AN663_RS27880 (AN663_27655) 758..1746 - 989 Protein_2 conjugal transfer pilus assembly protein TraU -
AN663_RS27885 (AN663_27660) 1743..2144 - 402 WP_004194979 hypothetical protein -
AN663_RS27890 (AN663_27665) 2179..2814 - 636 WP_032441885 type-F conjugative transfer system protein TraW traW
AN663_RS27895 (AN663_27670) 2814..3203 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
AN663_RS27900 (AN663_27675) 3200..5842 - 2643 WP_032454974 type IV secretion system protein TraC virb4
AN663_RS27905 (AN663_27680) 5914..6312 - 399 WP_074184101 hypothetical protein -
AN663_RS27920 (AN663_27695) 6690..7094 - 405 WP_004197817 hypothetical protein -
AN663_RS27925 (AN663_27700) 7161..7472 - 312 WP_004195240 hypothetical protein -
AN663_RS27930 (AN663_27705) 7473..7691 - 219 WP_004195235 hypothetical protein -
AN663_RS27935 (AN663_27710) 7797..8207 - 411 WP_004152499 hypothetical protein -
AN663_RS27940 (AN663_27715) 8339..8923 - 585 WP_032441881 type IV conjugative transfer system lipoprotein TraV traV
AN663_RS27945 (AN663_27720) 9037..10461 - 1425 WP_023284634 F-type conjugal transfer pilus assembly protein TraB traB
AN663_RS27950 (AN663_27725) 10461..11201 - 741 WP_013214019 type-F conjugative transfer system secretin TraK traK
AN663_RS27955 (AN663_27730) 11188..11754 - 567 WP_004144423 type IV conjugative transfer system protein TraE traE
AN663_RS27960 (AN663_27735) 11774..12079 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
AN663_RS27965 (AN663_27740) 12093..12461 - 369 WP_020316649 type IV conjugative transfer system pilin TraA -
AN663_RS27975 (AN663_27750) 12814..13518 - 705 WP_050442685 hypothetical protein -
AN663_RS27980 (AN663_27755) 13756..14148 - 393 WP_020805752 conjugal transfer relaxosome DNA-binding protein TraM -
AN663_RS27985 (AN663_27760) 14580..15065 + 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
AN663_RS27990 (AN663_27765) 15098..15427 - 330 WP_011977736 DUF5983 family protein -
AN663_RS27995 (AN663_27770) 15460..16281 - 822 WP_032454971 DUF932 domain-containing protein -
AN663_RS28005 (AN663_27785) 17097..17496 - 400 Protein_23 hypothetical protein -

Host bacterium

ID   5201 GenBank   NZ_CP023488
Plasmid name   p19-10_01 Incompatibility group   IncFIB
Plasmid size   223434 bp Coordinate of oriT [Strand]   14459..14507 [+]
Host baterium   Klebsiella pneumoniae subsp. pneumoniae strain ST101:960186733

Cargo genes

Drug resistance gene   dfrA14, tet(D), blaNDM-1, sul1, armA, msr(E), mph(E), aph(6)-Id, aph(3'')-Ib, sul2
Virulence gene   -
Metal resistance gene   silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsH, arsC, arsB, arsA, arsD, arsR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -