Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104713 |
| Name | oriT1_pNGBS128  |
| Organism | Streptococcus agalactiae strain NGBS128 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP012742 (2183..2223 [-], 41 nt) |
| oriT length | 41 nt |
| IRs (inverted repeats) | 15..23, 29..37 (TAAAGTATA..TATACTTTA) 4..9, 12..17 (TTATAT..ATATAA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 41 nt
>oriT1_pNGBS128
CACTTATATGAATATAAAGTATAGTATGTATACTTTACATG
CACTTATATGAATATAAAGTATAGTATGTATACTTTACATG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 3369 | GenBank | WP_235585363 |
| Name | Mob_Pre_AMM49_RS11395_pNGBS128 |
UniProt ID | _ |
| Length | 111 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 111 a.a. Molecular weight: 13235.77 Da Isoelectric Point: 8.0242
>WP_235585363.1 plasmid recombination protein [Streptococcus agalactiae]
MSYLVARMQKMKVGNLGGAYRHNERVFENHSNKDIDTSRSHLNYELTDRDRSVSYEKQIKDYVNEKKSSK
RAIRKDAGLCDEWIITSDKDFFERLDQEQTRAFFETAKIYE
MSYLVARMQKMKVGNLGGAYRHNERVFENHSNKDIDTSRSHLNYELTDRDRSVSYEKQIKDYVNEKKSSK
RAIRKDAGLCDEWIITSDKDFFERLDQEQTRAFFETAKIYE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Host bacterium
| ID | 5152 | GenBank | NZ_CP012742 |
| Plasmid name | pNGBS128 | Incompatibility group | - |
| Plasmid size | 4944 bp | Coordinate of oriT [Strand] | 2183..2223 [-]; 3512..3549 [-] |
| Host baterium | Streptococcus agalactiae strain NGBS128 |
Cargo genes
| Drug resistance gene | erm(T) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |