Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104668
Name   oriT_pRM2968-2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Enteritidis str. RM2968
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP028153 (13492..13544 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pRM2968-2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3282 GenBank   WP_000338974
Name   t4cp2_SEEERM2968_RS24470_pRM2968-2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 31454..54972

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SEEERM2968_RS25350 (SEEERM2968_24370) 27938..28159 - 222 Protein_33 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SEEERM2968_RS24420 (SEEERM2968_24400) 29744..30802 - 1059 WP_343229170 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SEEERM2968_RS24425 (SEEERM2968_24405) 30815..31450 - 636 WP_000934978 A24 family peptidase -
SEEERM2968_RS24430 (SEEERM2968_24410) 31454..31936 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
SEEERM2968_RS24435 (SEEERM2968_24415) 32002..32559 - 558 WP_000095048 type 4 pilus major pilin -
SEEERM2968_RS24440 (SEEERM2968_24420) 32604..33713 - 1110 WP_000974903 type II secretion system F family protein -
SEEERM2968_RS24445 (SEEERM2968_24425) 33704..35257 - 1554 WP_000466228 ATPase, T2SS/T4P/T4SS family virB11
SEEERM2968_RS24450 (SEEERM2968_24430) 35282..35776 - 495 WP_000912555 type IV pilus biogenesis protein PilP -
SEEERM2968_RS24455 (SEEERM2968_24435) 35760..37082 - 1323 WP_010895889 type 4b pilus protein PilO2 -
SEEERM2968_RS24460 (SEEERM2968_24440) 37121..38764 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
SEEERM2968_RS24465 (SEEERM2968_24445) 38757..39275 - 519 WP_069057551 sigma 54-interacting transcriptional regulator virb4
SEEERM2968_RS24470 (SEEERM2968_24450) 39322..41280 - 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
SEEERM2968_RS24475 (SEEERM2968_24455) 41296..42351 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
SEEERM2968_RS24480 (SEEERM2968_24460) 42426..43565 - 1140 WP_024222071 TrbI/VirB10 family protein virB10
SEEERM2968_RS24485 (SEEERM2968_24465) 43555..44256 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
SEEERM2968_RS24490 (SEEERM2968_24470) 44322..45056 - 735 WP_000432283 type IV secretion system protein virB8
SEEERM2968_RS24500 (SEEERM2968_24480) 45222..47579 - 2358 WP_069057550 VirB4 family type IV secretion system protein virb4
SEEERM2968_RS24505 (SEEERM2968_24485) 47585..47905 - 321 WP_010895893 VirB3 family type IV secretion system protein virB3
SEEERM2968_RS24910 47976..48266 - 291 WP_000865478 TrbC/VirB2 family protein virB2
SEEERM2968_RS24515 (SEEERM2968_24495) 48266..48850 - 585 WP_001177116 lytic transglycosylase domain-containing protein virB1
SEEERM2968_RS24520 (SEEERM2968_24500) 48871..49269 - 399 WP_001153669 hypothetical protein -
SEEERM2968_RS24525 (SEEERM2968_24505) 49388..49825 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
SEEERM2968_RS24530 (SEEERM2968_24510) 49831..51066 - 1236 WP_000733391 toxin co-regulated pilus biosynthesis Q family protein -
SEEERM2968_RS24535 (SEEERM2968_24515) 51069..51356 - 288 WP_029785630 TrbM/KikA/MpfK family conjugal transfer protein -
SEEERM2968_RS24540 (SEEERM2968_24520) 51528..52163 - 636 WP_000835769 hypothetical protein -
SEEERM2968_RS24545 (SEEERM2968_24525) 52211..53020 + 810 WP_024222072 DUF5710 domain-containing protein -
SEEERM2968_RS24550 (SEEERM2968_24530) 53073..53327 - 255 WP_000609210 EexN family lipoprotein -
SEEERM2968_RS24555 (SEEERM2968_24535) 53330..53971 - 642 WP_001434037 type IV secretion system protein -
SEEERM2968_RS24560 (SEEERM2968_24540) 53977..54972 - 996 WP_000276068 type IV secretion system protein virB6
SEEERM2968_RS24565 (SEEERM2968_24545) 54976..55233 - 258 WP_000739144 hypothetical protein -
SEEERM2968_RS24570 (SEEERM2968_24550) 55230..55532 - 303 WP_000189499 hypothetical protein -
SEEERM2968_RS24580 (SEEERM2968_24560) 55784..56338 - 555 WP_227004539 hypothetical protein -
SEEERM2968_RS24590 (SEEERM2968_24570) 56489..57151 - 663 WP_001243159 hypothetical protein -
SEEERM2968_RS24915 57162..57332 - 171 WP_000550721 hypothetical protein -
SEEERM2968_RS24595 (SEEERM2968_24575) 57336..57779 - 444 WP_000498521 NfeD family protein -
SEEERM2968_RS24600 (SEEERM2968_24580) 57841..58794 - 954 WP_072097371 SPFH domain-containing protein -
SEEERM2968_RS24920 58821..58997 - 177 WP_000753050 hypothetical protein -
SEEERM2968_RS24605 (SEEERM2968_24585) 58990..59205 - 216 WP_001127357 DUF1187 family protein -
SEEERM2968_RS24610 (SEEERM2968_24590) 59198..59650 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   5107 GenBank   NZ_CP028153
Plasmid name   pRM2968-2 Incompatibility group   IncI2
Plasmid size   60294 bp Coordinate of oriT [Strand]   13492..13544 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Enteritidis str. RM2968

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -