Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104608
Name   oriT_STEFF_15|unnamed2 in_silico
Organism   Raoultella ornithinolytica strain STEFF_15
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055218 (19044..19142 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_STEFF_15|unnamed2
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3313 GenBank   WP_000130000
Name   Replic_Relax_HUZ43_RS27615_STEFF_15|unnamed2 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   5047 GenBank   NZ_CP055218
Plasmid name   STEFF_15|unnamed2 Incompatibility group   IncR
Plasmid size   48095 bp Coordinate of oriT [Strand]   19044..19142 [+]
Host baterium   Raoultella ornithinolytica strain STEFF_15

Cargo genes

Drug resistance gene   aph(6)-Id, aph(3'')-Ib, mph(A), sul1, qacE, catA2, tet(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -