Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104604
Name   oriT_FO15|unnamed3 in_silico
Organism   Klebsiella pneumoniae strain FO15
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP073005 (19612..19664 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_FO15|unnamed3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3254 GenBank   WP_000338974
Name   t4cp2_KBT91_RS28255_FO15|unnamed3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 42439..60138

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KBT91_RS28125 38409..38915 + 507 WP_001358485 CaiF/GrlA family transcriptional regulator -
KBT91_RS28130 38908..39102 + 195 WP_000049865 DUF1187 family protein -
KBT91_RS28135 39148..40101 + 954 WP_072105959 SPFH domain-containing protein -
KBT91_RS28140 40174..40617 + 444 WP_000964840 NfeD family protein -
KBT91_RS28145 40621..40791 + 171 WP_000550721 hypothetical protein -
KBT91_RS28150 40802..41464 + 663 WP_001419740 hypothetical protein -
KBT91_RS28155 41648..41863 + 216 WP_001360344 hypothetical protein -
KBT91_RS28160 41879..42181 + 303 WP_001360345 hypothetical protein -
KBT91_RS28165 42178..42435 + 258 WP_000739144 hypothetical protein -
KBT91_RS28170 42439..43425 + 987 WP_001419739 type IV secretion system protein virB6
KBT91_RS28175 43431..44078 + 648 WP_001419738 type IV secretion system protein -
KBT91_RS28180 44082..44318 + 237 WP_000750964 EexN family lipoprotein -
KBT91_RS28185 44365..45174 - 810 WP_001419737 DUF5710 domain-containing protein -
KBT91_RS28190 45222..45854 + 633 WP_001419736 hypothetical protein -
KBT91_RS28195 45921..46220 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
KBT91_RS28200 46223..47458 + 1236 WP_001419735 TcpQ domain-containing protein -
KBT91_RS28205 47464..47901 + 438 WP_015387358 type IV pilus biogenesis protein PilM -
KBT91_RS28210 48241..48639 + 399 WP_001708012 hypothetical protein -
KBT91_RS28215 48660..49244 + 585 WP_001401693 lytic transglycosylase domain-containing protein virB1
KBT91_RS28220 49244..49534 + 291 WP_000865479 conjugal transfer protein -
KBT91_RS28225 49605..49925 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
KBT91_RS28230 49931..52288 + 2358 WP_015387356 VirB4 family type IV secretion system protein virb4
KBT91_RS28235 52452..53186 + 735 WP_000432282 type IV secretion system protein virB8
KBT91_RS28240 53252..53953 + 702 WP_053882504 TrbG/VirB9 family P-type conjugative transfer protein -
KBT91_RS28245 53943..55082 + 1140 WP_015387354 TrbI/VirB10 family protein virB10
KBT91_RS28250 55101..56156 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
KBT91_RS28255 56172..58130 + 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
KBT91_RS28260 58177..60138 + 1962 WP_241420257 PilN family type IVB pilus formation outer membrane protein virb4
KBT91_RS28265 60189..61499 + 1311 WP_001420476 type 4b pilus protein PilO2 -
KBT91_RS28270 61483..61977 + 495 WP_000912551 type IV pilus biogenesis protein PilP -


Host bacterium


ID   5043 GenBank   NZ_CP073005
Plasmid name   FO15|unnamed3 Incompatibility group   IncI2
Plasmid size   62001 bp Coordinate of oriT [Strand]   19612..19664 [+]
Host baterium   Klebsiella pneumoniae strain FO15

Cargo genes


Drug resistance gene   blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -