Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104600
Name   oriT_SWHEFF_72|unnamed3 in_silico
Organism   Klebsiella quasipneumoniae strain SWHEFF_72
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055013 (125266..125314 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_SWHEFF_72|unnamed3
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1482 GenBank   WP_020805752
Name   WP_020805752_SWHEFF_72|unnamed3 insolico UniProt ID   A0A377TIM3
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14772.81 Da        Isoelectric Point: 4.5715

>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A377TIM3


T4CP

ID   3252 GenBank   WP_239605192
Name   traD_HUZ79_RS29895_SWHEFF_72|unnamed3 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85327.11 Da        Isoelectric Point: 4.9167

>WP_239605192.1 type IV conjugative transfer system coupling protein TraD [Klebsiella quasipneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGERPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSARTAEPPVLQFTAVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 127693..155784

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUZ79_RS29690 (HUZ79_29595) 124146..124676 + 531 WP_101971407 antirestriction protein -
HUZ79_RS29695 (HUZ79_29600) 124714..125121 - 408 WP_224231152 transglycosylase SLT domain-containing protein -
HUZ79_RS29700 (HUZ79_29605) 125625..126017 + 393 WP_020805752 conjugal transfer relaxosome DNA-binding protein TraM -
HUZ79_RS29705 126255..126956 + 702 WP_239605189 hypothetical protein -
HUZ79_RS29710 (HUZ79_29615) 127042..127242 + 201 WP_004194116 TraY domain-containing protein -
HUZ79_RS29715 (HUZ79_29620) 127311..127679 + 369 WP_070612676 type IV conjugative transfer system pilin TraA -
HUZ79_RS29720 (HUZ79_29625) 127693..127998 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
HUZ79_RS29725 (HUZ79_29630) 128018..128584 + 567 WP_020804842 type IV conjugative transfer system protein TraE traE
HUZ79_RS29730 (HUZ79_29635) 128571..129311 + 741 WP_153650537 type-F conjugative transfer system secretin TraK traK
HUZ79_RS29735 (HUZ79_29640) 129311..130735 + 1425 WP_100632030 F-type conjugal transfer pilus assembly protein TraB traB
HUZ79_RS29740 (HUZ79_29645) 130728..131141 + 414 Protein_149 conjugal transfer pilus-stabilizing protein TraP -
HUZ79_RS29745 (HUZ79_29650) 131180..131335 + 156 WP_153650536 hypothetical protein -
HUZ79_RS29750 (HUZ79_29655) 131355..131939 + 585 WP_070612671 type IV conjugative transfer system lipoprotein TraV traV
HUZ79_RS29755 (HUZ79_29660) 132071..132481 + 411 WP_101827700 hypothetical protein -
HUZ79_RS29760 (HUZ79_29665) 132486..132770 + 285 WP_070612685 hypothetical protein -
HUZ79_RS29765 (HUZ79_29670) 132794..133012 + 219 WP_070612668 hypothetical protein -
HUZ79_RS29770 (HUZ79_29675) 133013..133324 + 312 WP_072124310 hypothetical protein -
HUZ79_RS29775 (HUZ79_29680) 133391..133795 + 405 WP_042939116 hypothetical protein -
HUZ79_RS29780 (HUZ79_29685) 133792..134082 + 291 WP_042939113 hypothetical protein -
HUZ79_RS29785 (HUZ79_29690) 134090..134488 + 399 WP_239605190 hypothetical protein -
HUZ79_RS29790 (HUZ79_29695) 134560..137199 + 2640 WP_239605191 type IV secretion system protein TraC virb4
HUZ79_RS29795 (HUZ79_29700) 137199..137588 + 390 WP_042939105 type-F conjugative transfer system protein TrbI -
HUZ79_RS29800 (HUZ79_29705) 137588..138214 + 627 WP_070612662 type-F conjugative transfer system protein TraW traW
HUZ79_RS29805 (HUZ79_29710) 138258..139217 + 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
HUZ79_RS29810 (HUZ79_29715) 139232..139780 + 549 WP_022631518 hypothetical protein -
HUZ79_RS29815 (HUZ79_29720) 139755..140444 - 690 WP_126834916 hypothetical protein -
HUZ79_RS29820 (HUZ79_29725) 140501..141103 + 603 WP_181511916 hypothetical protein -
HUZ79_RS29825 (HUZ79_29730) 141248..141895 + 648 WP_153650534 type-F conjugative transfer system pilin assembly protein TrbC trbC
HUZ79_RS29830 (HUZ79_29735) 141954..143909 + 1956 WP_042939088 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HUZ79_RS29835 (HUZ79_29740) 143942..144223 + 282 WP_022644736 hypothetical protein -
HUZ79_RS29840 (HUZ79_29745) 144213..144440 + 228 WP_012540032 conjugal transfer protein TrbE -
HUZ79_RS29845 (HUZ79_29750) 144451..144777 + 327 WP_012539967 hypothetical protein -
HUZ79_RS29850 (HUZ79_29755) 144798..145550 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
HUZ79_RS29855 (HUZ79_29760) 145561..145800 + 240 WP_023340931 type-F conjugative transfer system pilin chaperone TraQ -
HUZ79_RS29860 (HUZ79_29765) 145772..146329 + 558 WP_032433944 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HUZ79_RS29865 (HUZ79_29770) 146375..146818 + 444 WP_153650532 F-type conjugal transfer protein TrbF -
HUZ79_RS29870 (HUZ79_29775) 146796..148175 + 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
HUZ79_RS29875 (HUZ79_29780) 148175..151018 + 2844 WP_070612650 conjugal transfer mating-pair stabilization protein TraG traG
HUZ79_RS29880 (HUZ79_29785) 151021..151551 + 531 WP_077270072 conjugal transfer protein TraS -
HUZ79_RS29885 (HUZ79_29790) 151742..152473 + 732 WP_004152629 conjugal transfer complement resistance protein TraT -
HUZ79_RS29890 (HUZ79_29795) 152666..153358 + 693 WP_172971311 hypothetical protein -
HUZ79_RS29895 (HUZ79_29800) 153484..155784 + 2301 WP_239605192 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   5039 GenBank   NZ_CP055013
Plasmid name   SWHEFF_72|unnamed3 Incompatibility group   IncFIA
Plasmid size   167218 bp Coordinate of oriT [Strand]   125266..125314 [-]
Host baterium   Klebsiella quasipneumoniae strain SWHEFF_72

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9