Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104588
Name   oriT_STIN_90|unnamed2 in_silico
Organism   Klebsiella pneumoniae strain STIN_90
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP054986 (91970..92018 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_STIN_90|unnamed2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3241 GenBank   WP_013023832
Name   traD_HUZ59_RS27275_STIN_90|unnamed2 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85974.10 Da        Isoelectric Point: 5.1149

>WP_013023832.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 73225..92576

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUZ59_RS27375 (HUZ59_27325) 68873..69067 + 195 Protein_81 transposase -
HUZ59_RS27380 (HUZ59_27330) 69402..70277 + 876 WP_011091028 extended-spectrum class A beta-lactamase CTX-M-3 -
HUZ59_RS27385 (HUZ59_27335) 70324..70800 - 477 WP_013023839 WbuC family cupin fold metalloprotein -
HUZ59_RS27390 (HUZ59_27340) 71059..71919 - 861 WP_000027057 broad-spectrum class A beta-lactamase TEM-1 -
HUZ59_RS27395 (HUZ59_27345) 72123..72827 + 705 WP_001067858 IS6-like element IS26 family transposase -
HUZ59_RS27400 (HUZ59_27350) 72880..73179 - 300 Protein_86 F-type conjugal transfer protein TrbF -
HUZ59_RS27405 (HUZ59_27355) 73225..73782 - 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HUZ59_RS27410 (HUZ59_27360) 73754..73993 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
HUZ59_RS27415 (HUZ59_27365) 74004..74756 - 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
HUZ59_RS27420 (HUZ59_27370) 74777..75103 - 327 WP_004152676 hypothetical protein -
HUZ59_RS27425 (HUZ59_27375) 75116..75364 - 249 WP_004152675 hypothetical protein -
HUZ59_RS27430 (HUZ59_27380) 75342..75596 - 255 WP_004152674 conjugal transfer protein TrbE -
HUZ59_RS27435 (HUZ59_27385) 75628..77583 - 1956 WP_013023827 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HUZ59_RS27440 (HUZ59_27390) 77642..78280 - 639 WP_011977786 type-F conjugative transfer system pilin assembly protein TrbC trbC
HUZ59_RS27445 (HUZ59_27395) 78293..79282 - 990 WP_009309872 conjugal transfer pilus assembly protein TraU traU
HUZ59_RS27450 (HUZ59_27400) 79279..79668 - 390 WP_004194992 hypothetical protein -
HUZ59_RS27455 (HUZ59_27405) 79710..80336 - 627 WP_009309871 type-F conjugative transfer system protein TraW traW
HUZ59_RS27460 (HUZ59_27410) 80336..80725 - 390 WP_004197815 type-F conjugative transfer system protein TrbI -
HUZ59_RS27465 (HUZ59_27415) 80725..83364 - 2640 WP_013023824 type IV secretion system protein TraC virb4
HUZ59_RS27470 (HUZ59_27420) 83436..83834 - 399 WP_013609531 hypothetical protein -
HUZ59_RS27475 (HUZ59_27425) 84210..84614 - 405 WP_004197817 hypothetical protein -
HUZ59_RS27480 (HUZ59_27430) 84681..84992 - 312 WP_015344986 hypothetical protein -
HUZ59_RS27485 (HUZ59_27435) 84993..85211 - 219 WP_015344987 hypothetical protein -
HUZ59_RS27490 (HUZ59_27440) 85317..85727 - 411 WP_009309869 hypothetical protein -
HUZ59_RS27495 (HUZ59_27445) 85859..86443 - 585 WP_013023822 type IV conjugative transfer system lipoprotein TraV traV
HUZ59_RS27500 (HUZ59_27450) 86557..87981 - 1425 WP_004194260 F-type conjugal transfer pilus assembly protein TraB traB
HUZ59_RS27505 (HUZ59_27455) 87981..88721 - 741 WP_013023821 type-F conjugative transfer system secretin TraK traK
HUZ59_RS27510 (HUZ59_27460) 88708..89274 - 567 WP_004144423 type IV conjugative transfer system protein TraE traE
HUZ59_RS27515 (HUZ59_27465) 89294..89599 - 306 WP_004144424 type IV conjugative transfer system protein TraL traL
HUZ59_RS27520 (HUZ59_27470) 89613..89981 - 369 WP_004194426 type IV conjugative transfer system pilin TraA -
HUZ59_RS28825 (HUZ59_27475) 90050..90250 - 201 WP_004194116 TraY domain-containing protein -
HUZ59_RS27525 (HUZ59_27480) 90336..91037 - 702 WP_004194113 hypothetical protein -
HUZ59_RS27530 (HUZ59_27485) 91267..91659 - 393 WP_004194114 conjugal transfer relaxosome DNA-binding protein TraM -
HUZ59_RS27535 (HUZ59_27490) 92091..92576 + 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
HUZ59_RS27540 (HUZ59_27495) 92609..92938 - 330 WP_011977736 DUF5983 family protein -
HUZ59_RS27545 (HUZ59_27500) 92971..93792 - 822 WP_004152492 DUF932 domain-containing protein -
HUZ59_RS27550 (HUZ59_27505) 94600..95808 + 1209 WP_015344990 IS256 family transposase -
HUZ59_RS27555 (HUZ59_27510) 95944..96357 - 414 WP_013023817 helix-turn-helix domain-containing protein -
HUZ59_RS27560 (HUZ59_27515) 96358..96636 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
HUZ59_RS27565 (HUZ59_27520) 96626..96946 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
HUZ59_RS27570 (HUZ59_27525) 97027..97251 - 225 WP_004152719 hypothetical protein -
HUZ59_RS27575 (HUZ59_27530) 97262..97474 - 213 WP_013023815 hypothetical protein -


Host bacterium


ID   5027 GenBank   NZ_CP054986
Plasmid name   STIN_90|unnamed2 Incompatibility group   IncFII
Plasmid size   121235 bp Coordinate of oriT [Strand]   91970..92018 [+]
Host baterium   Klebsiella pneumoniae strain STIN_90

Cargo genes


Drug resistance gene   mph(A), sul1, qacE, aadA16, dfrA27, ARR-3, aac(6')-Ib-cr, aac(3)-IId, qnrS1, blaCTX-M-3, blaTEM-1B
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9