Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 104588 |
Name | oriT_STIN_90|unnamed2 |
Organism | Klebsiella pneumoniae strain STIN_90 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP054986 (91970..92018 [+], 49 nt) |
oriT length | 49 nt |
IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
Location of nic site | 32..33 |
Conserved sequence flanking the nic site |
GGTGTGGTGA |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_STIN_90|unnamed2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 3241 | GenBank | WP_013023832 |
Name | traD_HUZ59_RS27275_STIN_90|unnamed2 | UniProt ID | _ |
Length | 770 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85974.10 Da Isoelectric Point: 5.1149
>WP_013023832.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 73225..92576
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUZ59_RS27375 (HUZ59_27325) | 68873..69067 | + | 195 | Protein_81 | transposase | - |
HUZ59_RS27380 (HUZ59_27330) | 69402..70277 | + | 876 | WP_011091028 | extended-spectrum class A beta-lactamase CTX-M-3 | - |
HUZ59_RS27385 (HUZ59_27335) | 70324..70800 | - | 477 | WP_013023839 | WbuC family cupin fold metalloprotein | - |
HUZ59_RS27390 (HUZ59_27340) | 71059..71919 | - | 861 | WP_000027057 | broad-spectrum class A beta-lactamase TEM-1 | - |
HUZ59_RS27395 (HUZ59_27345) | 72123..72827 | + | 705 | WP_001067858 | IS6-like element IS26 family transposase | - |
HUZ59_RS27400 (HUZ59_27350) | 72880..73179 | - | 300 | Protein_86 | F-type conjugal transfer protein TrbF | - |
HUZ59_RS27405 (HUZ59_27355) | 73225..73782 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
HUZ59_RS27410 (HUZ59_27360) | 73754..73993 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
HUZ59_RS27415 (HUZ59_27365) | 74004..74756 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
HUZ59_RS27420 (HUZ59_27370) | 74777..75103 | - | 327 | WP_004152676 | hypothetical protein | - |
HUZ59_RS27425 (HUZ59_27375) | 75116..75364 | - | 249 | WP_004152675 | hypothetical protein | - |
HUZ59_RS27430 (HUZ59_27380) | 75342..75596 | - | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
HUZ59_RS27435 (HUZ59_27385) | 75628..77583 | - | 1956 | WP_013023827 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
HUZ59_RS27440 (HUZ59_27390) | 77642..78280 | - | 639 | WP_011977786 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
HUZ59_RS27445 (HUZ59_27395) | 78293..79282 | - | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
HUZ59_RS27450 (HUZ59_27400) | 79279..79668 | - | 390 | WP_004194992 | hypothetical protein | - |
HUZ59_RS27455 (HUZ59_27405) | 79710..80336 | - | 627 | WP_009309871 | type-F conjugative transfer system protein TraW | traW |
HUZ59_RS27460 (HUZ59_27410) | 80336..80725 | - | 390 | WP_004197815 | type-F conjugative transfer system protein TrbI | - |
HUZ59_RS27465 (HUZ59_27415) | 80725..83364 | - | 2640 | WP_013023824 | type IV secretion system protein TraC | virb4 |
HUZ59_RS27470 (HUZ59_27420) | 83436..83834 | - | 399 | WP_013609531 | hypothetical protein | - |
HUZ59_RS27475 (HUZ59_27425) | 84210..84614 | - | 405 | WP_004197817 | hypothetical protein | - |
HUZ59_RS27480 (HUZ59_27430) | 84681..84992 | - | 312 | WP_015344986 | hypothetical protein | - |
HUZ59_RS27485 (HUZ59_27435) | 84993..85211 | - | 219 | WP_015344987 | hypothetical protein | - |
HUZ59_RS27490 (HUZ59_27440) | 85317..85727 | - | 411 | WP_009309869 | hypothetical protein | - |
HUZ59_RS27495 (HUZ59_27445) | 85859..86443 | - | 585 | WP_013023822 | type IV conjugative transfer system lipoprotein TraV | traV |
HUZ59_RS27500 (HUZ59_27450) | 86557..87981 | - | 1425 | WP_004194260 | F-type conjugal transfer pilus assembly protein TraB | traB |
HUZ59_RS27505 (HUZ59_27455) | 87981..88721 | - | 741 | WP_013023821 | type-F conjugative transfer system secretin TraK | traK |
HUZ59_RS27510 (HUZ59_27460) | 88708..89274 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
HUZ59_RS27515 (HUZ59_27465) | 89294..89599 | - | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
HUZ59_RS27520 (HUZ59_27470) | 89613..89981 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
HUZ59_RS28825 (HUZ59_27475) | 90050..90250 | - | 201 | WP_004194116 | TraY domain-containing protein | - |
HUZ59_RS27525 (HUZ59_27480) | 90336..91037 | - | 702 | WP_004194113 | hypothetical protein | - |
HUZ59_RS27530 (HUZ59_27485) | 91267..91659 | - | 393 | WP_004194114 | conjugal transfer relaxosome DNA-binding protein TraM | - |
HUZ59_RS27535 (HUZ59_27490) | 92091..92576 | + | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
HUZ59_RS27540 (HUZ59_27495) | 92609..92938 | - | 330 | WP_011977736 | DUF5983 family protein | - |
HUZ59_RS27545 (HUZ59_27500) | 92971..93792 | - | 822 | WP_004152492 | DUF932 domain-containing protein | - |
HUZ59_RS27550 (HUZ59_27505) | 94600..95808 | + | 1209 | WP_015344990 | IS256 family transposase | - |
HUZ59_RS27555 (HUZ59_27510) | 95944..96357 | - | 414 | WP_013023817 | helix-turn-helix domain-containing protein | - |
HUZ59_RS27560 (HUZ59_27515) | 96358..96636 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
HUZ59_RS27565 (HUZ59_27520) | 96626..96946 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HUZ59_RS27570 (HUZ59_27525) | 97027..97251 | - | 225 | WP_004152719 | hypothetical protein | - |
HUZ59_RS27575 (HUZ59_27530) | 97262..97474 | - | 213 | WP_013023815 | hypothetical protein | - |
Host bacterium
ID | 5027 | GenBank | NZ_CP054986 |
Plasmid name | STIN_90|unnamed2 | Incompatibility group | IncFII |
Plasmid size | 121235 bp | Coordinate of oriT [Strand] | 91970..92018 [+] |
Host baterium | Klebsiella pneumoniae strain STIN_90 |
Cargo genes
Drug resistance gene | mph(A), sul1, qacE, aadA16, dfrA27, ARR-3, aac(6')-Ib-cr, aac(3)-IId, qnrS1, blaCTX-M-3, blaTEM-1B |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIE9 |