Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104575
Name   oriT_SWHIN_114|unnamed1 in_silico
Organism   Klebsiella pneumoniae strain SWHIN_114
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055088 (20907..21005 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_SWHIN_114|unnamed1
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3296 GenBank   WP_000130000
Name   Replic_Relax_HUZ89_RS27015_SWHIN_114|unnamed1 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium


ID   5014 GenBank   NZ_CP055088
Plasmid name   SWHIN_114|unnamed1 Incompatibility group   IncR
Plasmid size   42893 bp Coordinate of oriT [Strand]   20907..21005 [-]
Host baterium   Klebsiella pneumoniae strain SWHIN_114

Cargo genes


Drug resistance gene   tet(A), dfrA12, aadA2, qacE, sul1, mph(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -