Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104537
Name   oriT_STLIN_17|unnamed2 in_silico
Organism   Shigella flexneri strain STLIN_17
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP058782 (42266..42364 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_STLIN_17|unnamed2
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3277 GenBank   WP_000130000
Name   Replic_Relax_HZT03_RS23150_STLIN_17|unnamed2 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium


ID   4976 GenBank   NZ_CP058782
Plasmid name   STLIN_17|unnamed2 Incompatibility group   IncY
Plasmid size   54485 bp Coordinate of oriT [Strand]   42266..42364 [+]
Host baterium   Shigella flexneri strain STLIN_17

Cargo genes


Drug resistance gene   dfrA12, aadA2, qacE, sul1, mph(A), sul3, tet(A)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -