Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104529
Name   oriT_SWHIN_107|unnamed3 in_silico
Organism   Shigella flexneri strain SWHIN_107
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055102 (13655..13707 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_SWHIN_107|unnamed3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3206 GenBank   WP_039022943
Name   t4cp2_HUZ84_RS25035_SWHIN_107|unnamed3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73293.90 Da        Isoelectric Point: 9.1581

>WP_039022943.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQICSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 30168..53703

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUZ84_RS24970 (HUZ84_24755) 25513..26045 - 533 Protein_33 thermonuclease family protein -
HUZ84_RS24975 (HUZ84_24760) 26075..26728 - 654 WP_183121777 hypothetical protein -
HUZ84_RS24980 (HUZ84_24765) 26740..27864 - 1125 WP_000486719 site-specific integrase -
HUZ84_RS24985 (HUZ84_24770) 28230..29516 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HUZ84_RS24990 (HUZ84_24775) 29529..30164 - 636 WP_000934979 A24 family peptidase -
HUZ84_RS24995 (HUZ84_24780) 30168..30650 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HUZ84_RS25000 (HUZ84_24785) 30716..31273 - 558 WP_000095048 type 4 pilus major pilin -
HUZ84_RS25005 (HUZ84_24790) 31318..32427 - 1110 WP_000974903 type II secretion system F family protein -
HUZ84_RS25010 (HUZ84_24795) 32418..33956 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HUZ84_RS25015 (HUZ84_24800) 33981..34475 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
HUZ84_RS25020 (HUZ84_24805) 34459..35769 - 1311 WP_001454111 type 4b pilus protein PilO2 -
HUZ84_RS25025 (HUZ84_24810) 35820..37463 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
HUZ84_RS25030 (HUZ84_24815) 37456..37992 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
HUZ84_RS25035 (HUZ84_24820) 38039..39997 - 1959 WP_039022943 type IV secretory system conjugative DNA transfer family protein -
HUZ84_RS25040 (HUZ84_24825) 40013..41068 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
HUZ84_RS25045 (HUZ84_24830) 41087..42226 - 1140 WP_001542008 TrbI/VirB10 family protein virB10
HUZ84_RS25050 (HUZ84_24835) 42216..42917 - 702 WP_049824867 TrbG/VirB9 family P-type conjugative transfer protein -
HUZ84_RS25055 (HUZ84_24840) 42983..43717 - 735 WP_000432282 type IV secretion system protein virB8
HUZ84_RS25060 (HUZ84_24845) 43883..46240 - 2358 WP_039022942 VirB4 family type IV secretion system protein virb4
HUZ84_RS25065 (HUZ84_24850) 46246..46566 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
HUZ84_RS25070 46637..46927 - 291 WP_000865479 conjugal transfer protein -
HUZ84_RS25075 (HUZ84_24860) 46927..47511 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
HUZ84_RS25080 (HUZ84_24865) 47532..47930 - 399 WP_001153669 hypothetical protein -
HUZ84_RS25085 (HUZ84_24870) 48049..48486 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
HUZ84_RS25090 (HUZ84_24875) 48492..49727 - 1236 WP_039022941 toxin co-regulated pilus biosynthesis Q family protein -
HUZ84_RS25095 (HUZ84_24880) 49730..50029 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HUZ84_RS25100 (HUZ84_24885) 50096..50731 - 636 WP_022645136 hypothetical protein -
HUZ84_RS25105 (HUZ84_24890) 50779..51570 + 792 WP_022645137 DUF5710 domain-containing protein -
HUZ84_RS25110 (HUZ84_24895) 51825..52049 - 225 WP_000713561 EexN family lipoprotein -
HUZ84_RS25115 (HUZ84_24900) 52058..52702 - 645 WP_001310442 type IV secretion system protein -
HUZ84_RS25120 (HUZ84_24905) 52708..53703 - 996 WP_001028541 type IV secretion system protein virB6
HUZ84_RS25125 (HUZ84_24910) 53707..53964 - 258 WP_000739144 hypothetical protein -
HUZ84_RS25130 (HUZ84_24915) 53961..54263 - 303 WP_001360345 hypothetical protein -
HUZ84_RS25135 (HUZ84_24920) 54534..54746 - 213 WP_039022940 hypothetical protein -
HUZ84_RS25140 (HUZ84_24925) 54757..54927 - 171 WP_000550720 hypothetical protein -
HUZ84_RS25145 (HUZ84_24930) 54931..55374 - 444 WP_072037179 NfeD family protein -
HUZ84_RS25150 (HUZ84_24935) 55748..56701 - 954 WP_072109880 SPFH domain-containing protein -
HUZ84_RS25155 (HUZ84_24940) 56728..56904 - 177 WP_000753050 hypothetical protein -
HUZ84_RS25160 (HUZ84_24945) 56897..57112 - 216 WP_001127357 DUF1187 family protein -
HUZ84_RS25165 (HUZ84_24950) 57105..57611 - 507 WP_039022938 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   4968 GenBank   NZ_CP055102
Plasmid name   SWHIN_107|unnamed3 Incompatibility group   IncI2
Plasmid size   58696 bp Coordinate of oriT [Strand]   13655..13707 [-]
Host baterium   Shigella flexneri strain SWHIN_107

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -