Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104434 |
| Name | oriT_pRHBSTW-00422_2  |
| Organism | Enterobacter sp. RHBSTW-00422 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP056553 (23870..23919 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..13, 18..24 (GCAAAAT..ATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pRHBSTW-00422_2
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3133 | GenBank | WP_032736842 |
| Name | traD_HV189_RS24685_pRHBSTW-00422_2 |
UniProt ID | _ |
| Length | 764 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 764 a.a. Molecular weight: 85398.61 Da Isoelectric Point: 5.0675
>WP_032736842.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDKPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDKPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1474..24472
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV189_RS24690 (HV189_24695) | 936..1463 | - | 528 | WP_032736843 | hypothetical protein | - |
| HV189_RS24695 (HV189_24700) | 1474..4317 | - | 2844 | WP_032736845 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HV189_RS24700 (HV189_24705) | 4317..5687 | - | 1371 | WP_032736846 | conjugal transfer pilus assembly protein TraH | traH |
| HV189_RS24705 (HV189_24710) | 5674..6237 | - | 564 | WP_224250969 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HV189_RS24710 (HV189_24715) | 6224..6460 | - | 237 | WP_032736848 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HV189_RS24715 (HV189_24720) | 6471..7223 | - | 753 | WP_042946285 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HV189_RS24720 (HV189_24725) | 7244..7570 | - | 327 | WP_032736851 | hypothetical protein | - |
| HV189_RS24725 (HV189_24730) | 7617..7802 | - | 186 | WP_032736852 | hypothetical protein | - |
| HV189_RS24730 (HV189_24735) | 7799..8035 | - | 237 | WP_032736854 | conjugal transfer protein TrbE | - |
| HV189_RS24735 (HV189_24740) | 8025..8636 | - | 612 | WP_032736855 | hypothetical protein | - |
| HV189_RS24740 (HV189_24745) | 8750..10693 | - | 1944 | WP_032736856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HV189_RS24745 (HV189_24750) | 10690..11316 | - | 627 | WP_032736857 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HV189_RS24750 (HV189_24755) | 11329..12288 | - | 960 | WP_088912317 | conjugal transfer pilus assembly protein TraU | traU |
| HV189_RS24755 (HV189_24760) | 12332..12958 | - | 627 | WP_042946288 | type-F conjugative transfer system protein TraW | traW |
| HV189_RS24760 (HV189_24765) | 12955..13344 | - | 390 | WP_032736860 | type-F conjugative transfer system protein TrbI | - |
| HV189_RS24765 (HV189_24770) | 13344..15983 | - | 2640 | WP_032736861 | type IV secretion system protein TraC | virb4 |
| HV189_RS24770 (HV189_24775) | 16076..16459 | - | 384 | WP_042946290 | hypothetical protein | - |
| HV189_RS24775 (HV189_24780) | 16546..16845 | - | 300 | WP_032736863 | hypothetical protein | - |
| HV189_RS25910 | 16842..17243 | - | 402 | WP_049077823 | hypothetical protein | - |
| HV189_RS24785 (HV189_24790) | 17328..17606 | - | 279 | WP_032736865 | hypothetical protein | - |
| HV189_RS24790 (HV189_24795) | 17718..18287 | - | 570 | WP_042946293 | type IV conjugative transfer system lipoprotein TraV | traV |
| HV189_RS24795 (HV189_24800) | 18307..18468 | - | 162 | WP_154235504 | hypothetical protein | - |
| HV189_RS24800 (HV189_24805) | 18461..19882 | - | 1422 | WP_032736866 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HV189_RS24805 (HV189_24810) | 19882..20616 | - | 735 | WP_032736867 | type-F conjugative transfer system secretin TraK | traK |
| HV189_RS24810 (HV189_24815) | 20603..21169 | - | 567 | WP_032736869 | type IV conjugative transfer system protein TraE | traE |
| HV189_RS24815 (HV189_24820) | 21189..21494 | - | 306 | WP_032736870 | type IV conjugative transfer system protein TraL | traL |
| HV189_RS24820 (HV189_24825) | 21508..21876 | - | 369 | WP_032736871 | type IV conjugative transfer system pilin TraA | - |
| HV189_RS24825 (HV189_24830) | 21945..22145 | - | 201 | WP_060415469 | TraY domain-containing protein | - |
| HV189_RS24830 (HV189_24835) | 22230..22931 | - | 702 | WP_032736872 | hypothetical protein | - |
| HV189_RS24835 (HV189_24840) | 23170..23562 | - | 393 | WP_032736874 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HV189_RS24840 (HV189_24845) | 23993..24472 | + | 480 | WP_032716648 | transglycosylase SLT domain-containing protein | virB1 |
| HV189_RS24845 (HV189_24850) | 24510..25040 | - | 531 | WP_032716647 | antirestriction protein | - |
| HV189_RS24850 (HV189_24855) | 25725..25871 | - | 147 | WP_032700834 | hypothetical protein | - |
| HV189_RS24855 (HV189_24860) | 25965..26312 | - | 348 | WP_032700835 | hypothetical protein | - |
| HV189_RS24860 (HV189_24865) | 26338..26496 | - | 159 | WP_162180130 | hypothetical protein | - |
| HV189_RS24865 (HV189_24870) | 26553..26828 | - | 276 | WP_032700867 | hypothetical protein | - |
| HV189_RS24870 (HV189_24875) | 27647..27928 | - | 282 | WP_004118961 | helix-turn-helix transcriptional regulator | - |
| HV189_RS24875 (HV189_24880) | 27909..28238 | - | 330 | WP_004118963 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HV189_RS25915 | 28558..28645 | - | 88 | Protein_39 | theronine dehydrogenase | - |
| HV189_RS24880 (HV189_24885) | 28642..29370 | - | 729 | WP_004118966 | plasmid SOS inhibition protein A | - |
Host bacterium
| ID | 4873 | GenBank | NZ_CP056553 |
| Plasmid name | pRHBSTW-00422_2 | Incompatibility group | IncFIA |
| Plasmid size | 163659 bp | Coordinate of oriT [Strand] | 23870..23919 [+] |
| Host baterium | Enterobacter sp. RHBSTW-00422 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | mrkJ, mrkF, mrkD, mrkC, mrkB, mrkA |
| Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |