Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104429
Name   oriT_STLE2|unnamed1 in_silico
Organism   Klebsiella pneumoniae strain STLE2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP058858 (8763..8861 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_STLE2|unnamed1
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3221 GenBank   WP_000130000
Name   Replic_Relax_HZT19_RS26930_STLE2|unnamed1 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   4868 GenBank   NZ_CP058858
Plasmid name   STLE2|unnamed1 Incompatibility group   IncR
Plasmid size   43449 bp Coordinate of oriT [Strand]   8763..8861 [-]
Host baterium   Klebsiella pneumoniae strain STLE2

Cargo genes

Drug resistance gene   tet(A), dfrA12, aadA2, qacE, sul1, mph(A), aph(3')-Ia
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -