Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104407 |
| Name | oriT_pRHBSTW-00405_3  |
| Organism | Klebsiella pneumoniae strain RHBSTW-00405 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP055519 (73371..73420 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pRHBSTW-00405_3
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3125 | GenBank | WP_060598860 |
| Name | traD_HV185_RS27550_pRHBSTW-00405_3 |
UniProt ID | _ |
| Length | 766 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 766 a.a. Molecular weight: 85363.18 Da Isoelectric Point: 4.9167
>WP_060598860.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSPRTAEPPVLRVTTVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 75807..104855
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV185_RS27340 (HV185_27350) | 72251..72781 | + | 531 | WP_015632491 | antirestriction protein | - |
| HV185_RS27345 (HV185_27355) | 72819..73226 | - | 408 | WP_020805750 | transglycosylase SLT domain-containing protein | - |
| HV185_RS27350 (HV185_27360) | 73689..74105 | + | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HV185_RS27355 (HV185_27365) | 74305..75024 | + | 720 | WP_165785303 | conjugal transfer protein TrbJ | - |
| HV185_RS27360 (HV185_27370) | 75157..75375 | + | 219 | WP_172619300 | TraY domain-containing protein | - |
| HV185_RS27365 (HV185_27375) | 75425..75793 | + | 369 | WP_181466020 | type IV conjugative transfer system pilin TraA | - |
| HV185_RS27370 (HV185_27380) | 75807..76112 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| HV185_RS27375 (HV185_27385) | 76132..76698 | + | 567 | WP_004194424 | type IV conjugative transfer system protein TraE | traE |
| HV185_RS27380 (HV185_27390) | 76685..77425 | + | 741 | WP_032738531 | type-F conjugative transfer system secretin TraK | traK |
| HV185_RS27385 (HV185_27395) | 77425..78849 | + | 1425 | WP_181466021 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HV185_RS27390 (HV185_27400) | 78842..79438 | + | 597 | WP_181466022 | conjugal transfer pilus-stabilizing protein TraP | - |
| HV185_RS27395 (HV185_27405) | 79461..80045 | + | 585 | WP_015632500 | type IV conjugative transfer system lipoprotein TraV | traV |
| HV185_RS27400 (HV185_27410) | 80177..80587 | + | 411 | WP_048263635 | hypothetical protein | - |
| HV185_RS27405 (HV185_27415) | 80592..80876 | + | 285 | WP_064155748 | hypothetical protein | - |
| HV185_RS27410 (HV185_27420) | 80900..81118 | + | 219 | WP_181466023 | hypothetical protein | - |
| HV185_RS27415 (HV185_27425) | 81119..81430 | + | 312 | WP_064155728 | hypothetical protein | - |
| HV185_RS27420 (HV185_27430) | 81497..81901 | + | 405 | WP_181466024 | hypothetical protein | - |
| HV185_RS27425 (HV185_27435) | 81944..82267 | + | 324 | WP_072124277 | hypothetical protein | - |
| HV185_RS27430 (HV185_27440) | 82275..82673 | + | 399 | WP_167876422 | hypothetical protein | - |
| HV185_RS27435 (HV185_27445) | 82745..85384 | + | 2640 | WP_181466025 | type IV secretion system protein TraC | virb4 |
| HV185_RS27440 (HV185_27450) | 85384..85773 | + | 390 | WP_181466026 | type-F conjugative transfer system protein TrbI | - |
| HV185_RS27445 (HV185_27455) | 85773..86399 | + | 627 | WP_020314628 | type-F conjugative transfer system protein TraW | traW |
| HV185_RS27450 (HV185_27460) | 86443..87402 | + | 960 | WP_029497356 | conjugal transfer pilus assembly protein TraU | traU |
| HV185_RS27455 (HV185_27465) | 87417..87965 | + | 549 | WP_181466027 | hypothetical protein | - |
| HV185_RS27460 (HV185_27470) | 87989..88591 | + | 603 | WP_048263627 | hypothetical protein | - |
| HV185_RS27465 (HV185_27475) | 88866..89408 | + | 543 | WP_100632040 | hypothetical protein | - |
| HV185_RS27470 (HV185_27480) | 89486..90031 | + | 546 | WP_228725669 | hypothetical protein | - |
| HV185_RS27475 (HV185_27485) | 90071..90718 | + | 648 | WP_100632041 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HV185_RS27480 (HV185_27490) | 90715..91098 | + | 384 | WP_181466028 | hypothetical protein | - |
| HV185_RS27485 (HV185_27495) | 91095..93050 | + | 1956 | WP_181466029 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HV185_RS27490 (HV185_27500) | 93083..93364 | + | 282 | WP_022644736 | hypothetical protein | - |
| HV185_RS27495 (HV185_27505) | 93354..93581 | + | 228 | WP_012540032 | conjugal transfer protein TrbE | - |
| HV185_RS27500 (HV185_27510) | 93592..93918 | + | 327 | WP_020323521 | hypothetical protein | - |
| HV185_RS27505 (HV185_27515) | 93939..94691 | + | 753 | WP_181466030 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HV185_RS27510 (HV185_27520) | 94702..94941 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HV185_RS27515 (HV185_27525) | 94913..95470 | + | 558 | WP_020804677 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HV185_RS27520 (HV185_27530) | 95516..95959 | + | 444 | WP_020316643 | F-type conjugal transfer protein TrbF | - |
| HV185_RS27525 (HV185_27535) | 95937..97316 | + | 1380 | WP_072198238 | conjugal transfer pilus assembly protein TraH | traH |
| HV185_RS27530 (HV185_27540) | 97316..100159 | + | 2844 | WP_181466031 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HV185_RS27535 (HV185_27545) | 100170..100703 | + | 534 | WP_101856268 | hypothetical protein | - |
| HV185_RS27540 (HV185_27550) | 101114..101845 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| HV185_RS27545 (HV185_27555) | 102220..102483 | + | 264 | WP_159106184 | hypothetical protein | - |
| HV185_RS27550 (HV185_27560) | 102555..104855 | + | 2301 | WP_060598860 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
| ID | 4846 | GenBank | NZ_CP055519 |
| Plasmid name | pRHBSTW-00405_3 | Incompatibility group | IncFIA |
| Plasmid size | 115594 bp | Coordinate of oriT [Strand] | 73371..73420 [-] |
| Host baterium | Klebsiella pneumoniae strain RHBSTW-00405 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |