Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104403 |
| Name | oriT_pRHBSTW-00574_2  |
| Organism | Klebsiella pneumoniae strain RHBSTW-00574 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP055452 (190637..190686 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pRHBSTW-00574_2
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3124 | GenBank | WP_040215031 |
| Name | traD_HV239_RS26610_pRHBSTW-00574_2 |
UniProt ID | _ |
| Length | 760 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 760 a.a. Molecular weight: 85020.03 Da Isoelectric Point: 4.9634
>WP_040215031.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLTMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDERVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSPPA
PAEMTVSPAPVKAPPTTKRPAAEPPVLPVTPIPLLKPKAAAAAATASSAGTPAAAAGGTEQELAQQSAEQ
GQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLTMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDERVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSPPA
PAEMTVSPAPVKAPPTTKRPAAEPPVLPVTPIPLLKPKAAAAAATASSAGTPAAAAGGTEQELAQQSAEQ
GQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNI
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 159981..191244
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV239_RS26610 (HV239_26615) | 159981..162263 | - | 2283 | WP_040215031 | type IV conjugative transfer system coupling protein TraD | virb4 |
| HV239_RS26615 (HV239_26620) | 162390..163079 | - | 690 | WP_165457226 | hypothetical protein | - |
| HV239_RS26620 (HV239_26625) | 163272..164003 | - | 732 | WP_013023830 | conjugal transfer complement resistance protein TraT | - |
| HV239_RS26625 (HV239_26630) | 164081..165049 | + | 969 | WP_072193976 | IS5-like element IS903B family transposase | - |
| HV239_RS26630 (HV239_26635) | 165378..165902 | - | 525 | WP_015065538 | hypothetical protein | - |
| HV239_RS26635 (HV239_26640) | 165913..168756 | - | 2844 | WP_032420975 | conjugal transfer mating-pair stabilization protein TraG | traG |
| HV239_RS26640 (HV239_26645) | 168756..170126 | - | 1371 | WP_004159274 | conjugal transfer pilus assembly protein TraH | traH |
| HV239_RS26645 (HV239_26650) | 170113..170541 | - | 429 | WP_015065560 | hypothetical protein | - |
| HV239_RS26650 (HV239_26655) | 170534..171106 | - | 573 | WP_023292147 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| HV239_RS26655 (HV239_26660) | 171078..171317 | - | 240 | WP_004152687 | type-F conjugative transfer system pilin chaperone TraQ | - |
| HV239_RS26660 (HV239_26665) | 171328..172080 | - | 753 | WP_020803149 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| HV239_RS26665 (HV239_26670) | 172101..172427 | - | 327 | WP_004144402 | hypothetical protein | - |
| HV239_RS26670 (HV239_26675) | 172440..172688 | - | 249 | WP_004152675 | hypothetical protein | - |
| HV239_RS26675 (HV239_26680) | 172666..172920 | - | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
| HV239_RS26680 (HV239_26685) | 172952..174907 | - | 1956 | WP_030003482 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| HV239_RS26685 (HV239_26690) | 174966..175604 | - | 639 | WP_004193871 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| HV239_RS26690 (HV239_26695) | 175617..176606 | - | 990 | WP_032441886 | conjugal transfer pilus assembly protein TraU | traU |
| HV239_RS26695 (HV239_26700) | 176603..177004 | - | 402 | WP_004194979 | hypothetical protein | - |
| HV239_RS26700 (HV239_26705) | 177039..177674 | - | 636 | WP_032441885 | type-F conjugative transfer system protein TraW | traW |
| HV239_RS26705 (HV239_26710) | 177674..178063 | - | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| HV239_RS26710 (HV239_26715) | 178060..180702 | - | 2643 | WP_032454974 | type IV secretion system protein TraC | virb4 |
| HV239_RS26715 (HV239_26720) | 180774..181172 | - | 399 | WP_023179972 | hypothetical protein | - |
| HV239_RS28010 | 181354..181506 | - | 153 | WP_224518895 | hypothetical protein | - |
| HV239_RS26725 (HV239_26730) | 181549..181953 | - | 405 | WP_117035163 | hypothetical protein | - |
| HV239_RS26730 (HV239_26735) | 182020..182331 | - | 312 | WP_025712701 | hypothetical protein | - |
| HV239_RS26735 (HV239_26740) | 182332..182550 | - | 219 | WP_074194505 | hypothetical protein | - |
| HV239_RS26740 (HV239_26745) | 182656..183066 | - | 411 | WP_078174848 | hypothetical protein | - |
| HV239_RS26745 (HV239_26750) | 183198..183782 | - | 585 | WP_013023822 | type IV conjugative transfer system lipoprotein TraV | traV |
| HV239_RS26750 (HV239_26755) | 183896..185320 | - | 1425 | WP_004194260 | F-type conjugal transfer pilus assembly protein TraB | traB |
| HV239_RS26755 (HV239_26760) | 185320..186060 | - | 741 | WP_015065528 | type-F conjugative transfer system secretin TraK | traK |
| HV239_RS26760 (HV239_26765) | 186047..186613 | - | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| HV239_RS26765 (HV239_26770) | 186633..186869 | - | 237 | Protein_210 | type IV conjugative transfer system protein TraL | - |
| HV239_RS28210 | 186839..187036 | - | 198 | WP_342636927 | hypothetical protein | - |
| HV239_RS26770 (HV239_26775) | 187018..187998 | - | 981 | WP_000019445 | IS5-like element ISKpn26 family transposase | - |
| HV239_RS26775 (HV239_26780) | 188065..188139 | - | 75 | Protein_213 | type IV conjugative transfer system protein TraL | - |
| HV239_RS26780 (HV239_26785) | 188153..188521 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| HV239_RS26785 (HV239_26790) | 188575..188946 | - | 372 | WP_004208838 | TraY domain-containing protein | - |
| HV239_RS26790 (HV239_26795) | 189030..189716 | - | 687 | WP_071561590 | transcriptional regulator TraJ family protein | - |
| HV239_RS26795 (HV239_26800) | 189932..190324 | - | 393 | WP_032441878 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| HV239_RS26800 (HV239_26805) | 190759..191244 | + | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| HV239_RS26805 (HV239_26810) | 191277..191606 | - | 330 | WP_011977736 | DUF5983 family protein | - |
| HV239_RS26810 (HV239_26815) | 191639..192460 | - | 822 | WP_023316395 | DUF932 domain-containing protein | - |
| HV239_RS26815 (HV239_26820) | 193288..193701 | - | 414 | WP_021312979 | helix-turn-helix domain-containing protein | - |
| HV239_RS26820 (HV239_26825) | 193702..193980 | - | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| HV239_RS26825 (HV239_26830) | 193970..194290 | - | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| HV239_RS26830 (HV239_26835) | 194371..194595 | - | 225 | WP_014343499 | hypothetical protein | - |
| HV239_RS26835 (HV239_26840) | 194606..194818 | - | 213 | WP_019706020 | hypothetical protein | - |
| HV239_RS26840 (HV239_26845) | 194879..195235 | - | 357 | WP_019706019 | hypothetical protein | - |
Host bacterium
| ID | 4842 | GenBank | NZ_CP055452 |
| Plasmid name | pRHBSTW-00574_2 | Incompatibility group | IncFIB |
| Plasmid size | 244871 bp | Coordinate of oriT [Strand] | 190637..190686 [+] |
| Host baterium | Klebsiella pneumoniae strain RHBSTW-00574 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | mrkA, mrkB, mrkC, mrkD, mrkF |
| Metal resistance gene | pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE, ncrA, ncrB, ncrC, ncrY |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |