Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104375
Name   oriT_pCTYH.Ch1_3 in_silico
Organism   Ensifer adhaerens strain CTYH.Ch1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP118613 (18435..18491 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pCTYH.Ch1_3
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3111 GenBank   WP_275028115
Name   t4cp2_PWG15_RS35980_pCTYH.Ch1_3 insolico UniProt ID   _
Length   698 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 698 a.a.        Molecular weight: 77679.69 Da        Isoelectric Point: 9.8402

>WP_275028115.1 type IV secretory system conjugative DNA transfer family protein [Ensifer adhaerens]
MTKQLQAFYLLFCVGIAFVGWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQLWHYKTSPALQKVALGS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDIASLRRGKWFRKQGHIFGRIGRNILRSKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGVISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYTKGGDPSVEMLSAQAKEEKPLTTAAAEAAPVKAEPAADQKAPAPAKRTVNKKALRPKPKATAANTGGA
EASASLDAMEARIKAIEEGLKPKAAQIKEVVDKKAEKLGDKSPTKRRNIMDIFSATIPDPVDVGMPAE

  Protein domains


Predicted by InterproScan.

(104-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 29565..39474

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PWG15_RS35975 (PWG15_35970) 25294..27420 - 2127 WP_275028114 AAA family ATPase -
PWG15_RS35980 (PWG15_35975) 27472..29568 - 2097 WP_275028115 type IV secretory system conjugative DNA transfer family protein -
PWG15_RS35985 (PWG15_35980) 29565..30593 - 1029 WP_275028116 P-type DNA transfer ATPase VirB11 virB11
PWG15_RS35990 (PWG15_35985) 30574..31785 - 1212 WP_275028118 type IV secretion system protein VirB10 virB10
PWG15_RS35995 (PWG15_35990) 31785..32594 - 810 WP_275028120 TrbG/VirB9 family P-type conjugative transfer protein virB9
PWG15_RS36000 (PWG15_35995) 32591..33286 - 696 WP_018210780 type IV secretion system protein virB8
PWG15_RS36005 (PWG15_36000) 33312..34340 - 1029 WP_275028122 type IV secretion system protein virB6
PWG15_RS36010 (PWG15_36005) 34356..34583 - 228 WP_088196646 hypothetical protein -
PWG15_RS36015 (PWG15_36010) 34573..35274 - 702 WP_275028155 type IV secretion system protein -
PWG15_RS36020 (PWG15_36015) 35286..36374 - 1089 WP_275028123 lytic transglycosylase domain-containing protein -
PWG15_RS36025 (PWG15_36020) 36371..38830 - 2460 WP_275028156 VirB4 family type IV secretion/conjugal transfer ATPase virb4
PWG15_RS36030 (PWG15_36025) 38833..39132 - 300 WP_014531077 VirB3 family type IV secretion system protein virB3
PWG15_RS36035 (PWG15_36030) 39136..39474 - 339 WP_015241462 TrbC/VirB2 family protein virB2
PWG15_RS36040 (PWG15_36035) 39486..40397 - 912 WP_275028157 lytic transglycosylase domain-containing protein -
PWG15_RS36045 (PWG15_36040) 40620..41228 + 609 WP_127664435 hypothetical protein -
PWG15_RS36050 (PWG15_36045) 41225..41761 + 537 WP_127664436 thermonuclease family protein -
PWG15_RS36055 (PWG15_36050) 41758..42459 + 702 WP_275028127 thermonuclease family protein -
PWG15_RS36060 (PWG15_36055) 42517..42852 + 336 WP_275028128 hypothetical protein -
PWG15_RS36065 (PWG15_36060) 42865..43461 + 597 WP_275028130 hypothetical protein -
PWG15_RS36070 (PWG15_36065) 43480..43896 + 417 WP_275028131 hypothetical protein -
PWG15_RS36075 (PWG15_36070) 43942..44277 - 336 WP_275028133 hypothetical protein -


Host bacterium


ID   4814 GenBank   NZ_CP118613
Plasmid name   pCTYH.Ch1_3 Incompatibility group   -
Plasmid size   123871 bp Coordinate of oriT [Strand]   18435..18491 [-]
Host baterium   Ensifer adhaerens strain CTYH.Ch1

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -