Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104360
Name   oriT_pKpCH_aerob in_silico
Organism   Klebsiella pneumoniae strain N447
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OP690162 (166413..166440 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_pKpCH_aerob
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   3105 GenBank   WP_004883405
Name   traD_P0Q75_RS00420_pKpCH_aerob insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79508.01 Da        Isoelectric Point: 8.6444

>WP_004883405.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSVYKLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPERNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

AAA-like domain (AAA_10)

(214-261)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 226205..250295

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P0Q75_RS01245 (OKNDNCAF_00272) 221922..222347 - 426 WP_040120489 IS200/IS605 family transposase -
P0Q75_RS01250 (OKNDNCAF_00273) 222384..223610 + 1227 WP_025368604 RNA-guided endonuclease TnpB family protein -
P0Q75_RS01255 223676..224802 - 1127 Protein_249 conjugal transfer protein TraG N-terminal domain-containing protein -
P0Q75_RS01260 (OKNDNCAF_00276) 225308..226156 + 849 WP_025368606 hypothetical protein -
P0Q75_RS01265 (OKNDNCAF_00277) 226205..229390 - 3186 WP_040120490 conjugal transfer protein TraN traN
P0Q75_RS01270 (OKNDNCAF_00278) 229400..230437 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
P0Q75_RS01275 (OKNDNCAF_00279) 230434..231795 - 1362 WP_094965818 TrbC family F-type conjugative pilus assembly protein traW
P0Q75_RS01280 (OKNDNCAF_00280) 231782..232306 - 525 WP_025368608 signal peptidase I -
P0Q75_RS01285 (OKNDNCAF_00281) 232444..233661 - 1218 WP_223817487 hypothetical protein -
P0Q75_RS01290 (OKNDNCAF_00282) 233658..236684 - 3027 WP_274944993 Ig-like domain-containing protein -
P0Q75_RS01295 (OKNDNCAF_00283) 236812..237348 - 537 WP_004181791 hypothetical protein -
P0Q75_RS01300 (OKNDNCAF_00284) 237336..237734 - 399 WP_274944994 hypothetical protein -
P0Q75_RS01305 (OKNDNCAF_00285) 237715..238173 - 459 WP_004196672 hypothetical protein -
P0Q75_RS01310 (OKNDNCAF_00286) 238857..239660 + 804 WP_004181793 metallophosphoesterase -
P0Q75_RS01315 (OKNDNCAF_00287) 239638..240366 + 729 WP_228289489 hypothetical protein -
P0Q75_RS01320 (OKNDNCAF_00288) 240353..240853 + 501 WP_004181795 hypothetical protein -
P0Q75_RS01325 (OKNDNCAF_00289) 240828..241241 + 414 WP_004196636 hypothetical protein -
P0Q75_RS01330 (OKNDNCAF_00290) 241268..243985 - 2718 WP_032451259 TraC family protein virb4
P0Q75_RS01335 (OKNDNCAF_00291) 244030..244743 - 714 WP_274944995 TraV family lipoprotein traV
P0Q75_RS01340 (OKNDNCAF_00292) 244777..245628 - 852 WP_025368610 disulfide isomerase -
P0Q75_RS01345 (OKNDNCAF_00293) 245631..246095 - 465 WP_004883002 membrane protein -
P0Q75_RS01350 (OKNDNCAF_00294) 246098..247468 - 1371 WP_004181800 TrbI/VirB10 family protein traB
P0Q75_RS01355 (OKNDNCAF_00295) 247428..247946 - 519 WP_004181801 hypothetical protein -
P0Q75_RS01360 (OKNDNCAF_00296) 247943..249112 - 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
P0Q75_RS01365 (OKNDNCAF_00297) 249114..249974 - 861 WP_004181802 TraE/TraK family type IV conjugative transfer system protein traE
P0Q75_RS01370 (OKNDNCAF_00298) 249993..250295 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
P0Q75_RS01375 (OKNDNCAF_00299) 250397..250765 - 369 WP_004026504 hypothetical protein -
P0Q75_RS01380 (OKNDNCAF_00301) 252040..252708 + 669 WP_004181805 hypothetical protein -
P0Q75_RS01385 (OKNDNCAF_00302) 252764..253528 + 765 WP_004883008 hypothetical protein -
P0Q75_RS01390 (OKNDNCAF_00303) 253656..254834 + 1179 WP_004026500 hypothetical protein -
P0Q75_RS01395 (OKNDNCAF_00304) 254876..255004 + 129 WP_004026499 hypothetical protein -

Host bacterium

ID   4799 GenBank   NZ_OP690162
Plasmid name   pKpCH_aerob Incompatibility group   IncFIB
Plasmid size   297473 bp Coordinate of oriT [Strand]   166413..166440 [+]
Host baterium   Klebsiella pneumoniae strain N447

Cargo genes

Drug resistance gene   catA1, ant(2'')-Ia, ant(3'')-Ia, qacE, sul1
Virulence gene   iucA, iucB, iucC, iutA
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -