Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 104252
• Name: oriT_SESURV_p1_0612|unnamed1
• Organism: Staphylococcus epidermidis strain SESURV_p1_0612
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP043785 (7818..7926 [+], 109 nt)
• oriT length: 109 nt
• IRs (inverted repeats): 52..58, 62..68 (TTGGGGA..TCCCCAA) 22..28, 35..41 (ATTTTTT..AAAAAAT) 24..31, 33..40 (TTTTTTAT..ATAAAAAA) 1..8, 14..21 (AGTGGCTA..TAGCCACT)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 109 nt

>oriT_SESURV_p1_0612|unnamed1
AGTGGCTAGCAATTAGCCACTATTTTTTTATTATAAAAAATCCTAAGGGGCTTGGGGAATATCCCCAACAAGCTGGCGACGCTATCACGTATGTGGCTAGCAAAGCCAA

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_F1620_RS12320_SESURV_p1_0612|unnamed1

• ID: 3123
• GenBank: WP_176295340
• Name: Relaxase_F1620_RS12320_SESURV_p1_0612|unnamed1
• UniProt ID: _
• Length: 225 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 225 a.a.
• Molecular weight: 26315.63 Da
• Isoelectric Point: 5.7827

>WP_176295340.1 relaxase/mobilization nuclease domain-containing protein, partial [Staphylococcus epidermidis]
ETGKKFNNNKQALRNVRDFNDEVCLEHGLSVPEKDTARLRYTQTEKAIADPNTKSTTQYSWKDEIREAID
QSQATNMDEFKDHLNQHGIEIERVTPKSITYRHLAEDKKVRGRKLGEDYNKGGIEDGFERQIQRQRQQER
DSDTECQPKRPTASRDEATERDTGVTQADWEQFAQDTNELERSRQAAESARLADEKARRDREERERAKQA
SRRIINNDRDHGLEL

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (1-131)

Protein structure

No available structure.

Host bacterium

• ID: 4691
• GenBank: NZ_CP043785
• Plasmid name: SESURV_p1_0612|unnamed1
• Incompatibility group: -
• Plasmid size: 7926 bp
• Coordinate of oriT [Strand]: 7818..7926 [+]
• Host baterium: Staphylococcus epidermidis strain SESURV_p1_0612

Cargo genes

• Drug resistance gene: -
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -