Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104222
Name   oriT_pCY32-1 in_silico
Organism   Proteus mirabilis strain CY32
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP118228 (5796..5900 [-], 105 nt)
oriT length   105 nt
IRs (inverted repeats)      6..11, 17..22  (GTTTCT..AGAAAC)
Location of nic site      33..34
Conserved sequence flanking the
  nic site  
 
 GTGCGCCCTC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 105 nt

>oriT_pCY32-1
GGGCAGTTTCTTGAAGAGAAACCGGTAAGTGCGCCCTCCCGTAAAATGACGGTCGGGGTTTGCGGTGTCTGTGCTCCGATGATAGCATAATGACAAGCACATAAC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3098 GenBank   WP_223820406
Name   Mob_Pre_PU712_RS19420_pCY32-1 insolico UniProt ID   _
Length   103 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 103 a.a.        Molecular weight: 11864.27 Da        Isoelectric Point: 7.7517

>WP_223820406.1 MULTISPECIES: plasmid recombination protein [Gammaproteobacteria]
MGTVAAALQHCYRDRETPNADQERTPDNDHLAARSTDEAMGKLRERLPEKRRKDAVLAVEYVMSASPEWW
QTASADQQREFFKRSTEWLAACRKFRCSATAMN

  Protein domains


Predicted by InterproScan.

(4-90)


  Protein structure



No available structure.




Host bacterium


ID   4661 GenBank   NZ_CP118228
Plasmid name   pCY32-1 Incompatibility group   IncQ1
Plasmid size   8441 bp Coordinate of oriT [Strand]   5796..5900 [-]
Host baterium   Proteus mirabilis strain CY32

Cargo genes


Drug resistance gene   floR
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -