Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104186 |
| Name | oriT_pKLP00177_3  |
| Organism | Klebsiella quasipneumoniae strain KLP00177 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_OP378657 (152101..152150 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKLP00177_3
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTCATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2974 | GenBank | WP_023313941 |
| Name | traD_PWC57_RS00685_pKLP00177_3 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85666.78 Da Isoelectric Point: 5.2499
>WP_023313941.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGTADTNSHAGEQPEPVSQPA
PAEVTVSPAPVKAPATTKMPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNKDGVIEDMQAYDAWADEQTLRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 121757..152708
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWC57_RS00685 | 121757..124066 | - | 2310 | WP_023313941 | type IV conjugative transfer system coupling protein TraD | virb4 |
| PWC57_RS00690 | 124193..124882 | - | 690 | WP_013023831 | hypothetical protein | - |
| PWC57_RS00695 | 125075..125509 | - | 435 | Protein_138 | complement resistance protein TraT | - |
| PWC57_RS00700 | 125524..126492 | + | 969 | WP_015958259 | IS5 family transposase | - |
| PWC57_RS00705 | 126549..126870 | - | 322 | Protein_140 | complement resistance protein TraT | - |
| PWC57_RS00710 | 127059..127586 | - | 528 | WP_032409657 | conjugal transfer protein TraS | - |
| PWC57_RS00715 | 127592..130441 | - | 2850 | WP_023287129 | conjugal transfer mating-pair stabilization protein TraG | traG |
| PWC57_RS00720 | 130441..131820 | - | 1380 | WP_072159474 | conjugal transfer pilus assembly protein TraH | traH |
| PWC57_RS00725 | 131798..132241 | - | 444 | WP_023287131 | F-type conjugal transfer protein TrbF | - |
| PWC57_RS00730 | 132287..132844 | - | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| PWC57_RS00735 | 132816..133055 | - | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| PWC57_RS00740 | 133066..133818 | - | 753 | WP_004152677 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| PWC57_RS00745 | 133839..134165 | - | 327 | WP_004152676 | hypothetical protein | - |
| PWC57_RS00750 | 134178..134426 | - | 249 | WP_013214029 | hypothetical protein | - |
| PWC57_RS00755 | 134404..134658 | - | 255 | WP_023287133 | conjugal transfer protein TrbE | - |
| PWC57_RS00760 | 134690..136645 | - | 1956 | WP_023287134 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| PWC57_RS00765 | 136704..137351 | - | 648 | WP_064757794 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| PWC57_RS00770 | 137627..138616 | - | 990 | WP_032439620 | conjugal transfer pilus assembly protein TraU | traU |
| PWC57_RS00775 | 138613..139014 | - | 402 | WP_016831047 | hypothetical protein | - |
| PWC57_RS00780 | 139049..139684 | - | 636 | WP_020325113 | type-F conjugative transfer system protein TraW | traW |
| PWC57_RS00785 | 139684..140073 | - | 390 | WP_004167468 | type-F conjugative transfer system protein TrbI | - |
| PWC57_RS00790 | 140073..142712 | - | 2640 | WP_032448278 | type IV secretion system protein TraC | virb4 |
| PWC57_RS00795 | 142784..143182 | - | 399 | WP_072159473 | hypothetical protein | - |
| PWC57_RS00800 | 143190..143579 | - | 390 | WP_065799586 | hypothetical protein | - |
| PWC57_RS00805 | 143622..144026 | - | 405 | WP_016831042 | hypothetical protein | - |
| PWC57_RS00810 | 144093..144404 | - | 312 | WP_014386200 | hypothetical protein | - |
| PWC57_RS00815 | 144405..144623 | - | 219 | WP_014386199 | hypothetical protein | - |
| PWC57_RS00820 | 144647..144937 | - | 291 | WP_014386198 | hypothetical protein | - |
| PWC57_RS00990 | 144942..145352 | - | 411 | WP_014386197 | hypothetical protein | - |
| PWC57_RS00830 | 145483..146067 | - | 585 | WP_014386196 | type IV conjugative transfer system lipoprotein TraV | traV |
| PWC57_RS00835 | 146114..146686 | - | 573 | WP_014386195 | conjugal transfer pilus-stabilizing protein TraP | - |
| PWC57_RS00840 | 146679..148103 | - | 1425 | WP_014386194 | F-type conjugal transfer pilus assembly protein TraB | traB |
| PWC57_RS00845 | 148103..148843 | - | 741 | WP_014386193 | type-F conjugative transfer system secretin TraK | traK |
| PWC57_RS00850 | 148830..149396 | - | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| PWC57_RS00855 | 149416..149721 | - | 306 | WP_049110928 | type IV conjugative transfer system protein TraL | traL |
| PWC57_RS00860 | 149735..150103 | - | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| PWC57_RS00865 | 150165..150371 | - | 207 | WP_171773970 | TraY domain-containing protein | - |
| PWC57_RS00870 | 150504..151223 | - | 720 | WP_014386192 | conjugal transfer protein | - |
| PWC57_RS00875 | 151416..151832 | - | 417 | WP_072145360 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PWC57_RS00880 | 152223..152708 | + | 486 | WP_004178063 | transglycosylase SLT domain-containing protein | virB1 |
| PWC57_RS00885 | 152741..153070 | - | 330 | WP_014386191 | DUF5983 family protein | - |
| PWC57_RS00890 | 153103..153924 | - | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| PWC57_RS00895 | 154753..155165 | - | 413 | Protein_178 | helix-turn-helix domain-containing protein | - |
| PWC57_RS00900 | 155166..155444 | - | 279 | WP_156658737 | helix-turn-helix transcriptional regulator | - |
| PWC57_RS00905 | 155434..155750 | - | 317 | Protein_180 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PWC57_RS00910 | 156064..156276 | - | 213 | WP_014386188 | hypothetical protein | - |
| PWC57_RS00915 | 156338..156660 | - | 323 | Protein_182 | hypothetical protein | - |
Host bacterium
| ID | 4625 | GenBank | NZ_OP378657 |
| Plasmid name | pKLP00177_3 | Incompatibility group | IncFIB |
| Plasmid size | 170816 bp | Coordinate of oriT [Strand] | 152101..152150 [+] |
| Host baterium | Klebsiella quasipneumoniae strain KLP00177 |
Cargo genes
| Drug resistance gene | sul2, aph(3'')-Ib, aph(6)-Id, blaTEM-1B, blaCTX-M-15, aac(3)-IIa, qnrB1, tet(A), aac(6')-Ib-cr, blaOXA-1, dfrA14 |
| Virulence gene | - |
| Metal resistance gene | silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, arsB, arsC, arsH |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |