Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104184 |
| Name | oriT_pKLO00023_2  |
| Organism | Klebsiella michiganensis strain KLO00023 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_OP378644 (149236..149285 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..13, 18..24 (GCAAAAT..ATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pKLO00023_2
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2973 | GenBank | WP_064411283 |
| Name | traD_PWC60_RS00685_pKLO00023_2 |
UniProt ID | _ |
| Length | 764 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 764 a.a. Molecular weight: 85384.54 Da Isoelectric Point: 5.0132
>WP_064411283.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDNPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDNPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 123992..149838
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWC60_RS00685 | 123992..126286 | - | 2295 | WP_064411283 | type IV conjugative transfer system coupling protein TraD | virb4 |
| PWC60_RS00690 | 126494..127021 | - | 528 | WP_064411282 | hypothetical protein | - |
| PWC60_RS00695 | 127032..129875 | - | 2844 | Protein_138 | conjugal transfer mating-pair stabilization protein TraG | - |
| PWC60_RS00700 | 129875..131245 | - | 1371 | WP_082238101 | conjugal transfer pilus assembly protein TraH | traH |
| PWC60_RS00705 | 131232..131792 | - | 561 | WP_082238100 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| PWC60_RS00710 | 131767..132003 | - | 237 | WP_053390221 | type-F conjugative transfer system pilin chaperone TraQ | - |
| PWC60_RS00715 | 132014..132766 | - | 753 | WP_082238099 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| PWC60_RS00720 | 132787..133113 | - | 327 | WP_082238098 | hypothetical protein | - |
| PWC60_RS00725 | 133159..133401 | - | 243 | WP_082238097 | conjugal transfer protein TrbE | - |
| PWC60_RS00730 | 133391..133903 | - | 513 | WP_274066407 | hypothetical protein | - |
| PWC60_RS00735 | 134116..136059 | - | 1944 | WP_032736856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| PWC60_RS00740 | 136056..136682 | - | 627 | WP_082238095 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| PWC60_RS00745 | 136695..137654 | - | 960 | WP_088912317 | conjugal transfer pilus assembly protein TraU | traU |
| PWC60_RS00750 | 137698..138324 | - | 627 | WP_042946288 | type-F conjugative transfer system protein TraW | traW |
| PWC60_RS00755 | 138321..138710 | - | 390 | WP_032736860 | type-F conjugative transfer system protein TrbI | - |
| PWC60_RS00760 | 138710..141349 | - | 2640 | WP_032736861 | type IV secretion system protein TraC | virb4 |
| PWC60_RS00765 | 141442..141825 | - | 384 | WP_042946290 | hypothetical protein | - |
| PWC60_RS00770 | 141912..142211 | - | 300 | WP_032736863 | hypothetical protein | - |
| PWC60_RS00775 | 142208..142609 | - | 402 | WP_032736864 | hypothetical protein | - |
| PWC60_RS00780 | 142694..142972 | - | 279 | WP_032736865 | hypothetical protein | - |
| PWC60_RS00785 | 143084..143653 | - | 570 | WP_042946293 | type IV conjugative transfer system lipoprotein TraV | traV |
| PWC60_RS00790 | 143827..145248 | - | 1422 | WP_032736866 | F-type conjugal transfer pilus assembly protein TraB | traB |
| PWC60_RS00795 | 145248..145982 | - | 735 | WP_032736867 | type-F conjugative transfer system secretin TraK | traK |
| PWC60_RS00800 | 145969..146535 | - | 567 | WP_032736869 | type IV conjugative transfer system protein TraE | traE |
| PWC60_RS00805 | 146555..146860 | - | 306 | WP_032736870 | type IV conjugative transfer system protein TraL | traL |
| PWC60_RS00810 | 146874..147242 | - | 369 | WP_032736871 | type IV conjugative transfer system pilin TraA | - |
| PWC60_RS00815 | 147311..147511 | - | 201 | WP_060415469 | TraY domain-containing protein | - |
| PWC60_RS00820 | 147596..148288 | - | 693 | WP_181717165 | hypothetical protein | - |
| PWC60_RS00825 | 148536..148928 | - | 393 | WP_032736874 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PWC60_RS00830 | 149359..149838 | + | 480 | WP_032716648 | transglycosylase SLT domain-containing protein | virB1 |
| PWC60_RS00835 | 149876..150406 | - | 531 | WP_032716647 | antirestriction protein | - |
| PWC60_RS00840 | 151091..151237 | - | 147 | WP_032700834 | hypothetical protein | - |
| PWC60_RS00845 | 151331..151678 | - | 348 | WP_032700835 | hypothetical protein | - |
| PWC60_RS00850 | 151704..151862 | - | 159 | WP_162180130 | hypothetical protein | - |
| PWC60_RS00855 | 151919..152194 | - | 276 | WP_032700867 | hypothetical protein | - |
| PWC60_RS00860 | 152456..152746 | + | 291 | WP_004118958 | hypothetical protein | - |
| PWC60_RS00865 | 153013..153294 | - | 282 | WP_004118961 | helix-turn-helix transcriptional regulator | - |
| PWC60_RS00870 | 153275..153604 | - | 330 | WP_004118963 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PWC60_RS00875 | 153924..154011 | - | 88 | Protein_174 | theronine dehydrogenase | - |
| PWC60_RS00880 | 154008..154736 | - | 729 | WP_112150740 | plasmid SOS inhibition protein A | - |
Host bacterium
| ID | 4623 | GenBank | NZ_OP378644 |
| Plasmid name | pKLO00023_2 | Incompatibility group | IncFIB |
| Plasmid size | 172081 bp | Coordinate of oriT [Strand] | 149236..149285 [+] |
| Host baterium | Klebsiella michiganensis strain KLO00023 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | mrkA, mrkB, mrkC, mrkJ |
| Metal resistance gene | arsR, arsD, arsA, arsB, arsC, merR, merT, merP, merA, merD, merE, silE, silS, silR, silC, silF, silB, silA, silP, pcoA, pcoB, pcoC, pcoD, pcoR, pcoS, pcoE, ncrC, ncrB, ncrA, chrA |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |