Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104121
Name   oriT_2022CK-00781|unnamed4 in_silico
Organism   Klebsiella grimontii strain 2022CK-00781
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117734 (28877..28925 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_2022CK-00781|unnamed4
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1301 GenBank   WP_020804860
Name   WP_020804860_2022CK-00781|unnamed4 insolico UniProt ID   A0A7H9GLQ1
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 15022.07 Da        Isoelectric Point: 4.5248

>WP_020804860.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Enterobacteriaceae]
MGKVQAYPSDEVCEKINAIVEKRRMEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESVVKTQFSVNKVLGIECLSPHVKDDPRWQWKGMVQNIQEDVQEVMRTFFPDEQEEADE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A7H9GLQ1


T4CP

ID   2923 GenBank   WP_009309880
Name   traD_PTC90_RS31700_2022CK-00781|unnamed4 insolico UniProt ID   _
Length   769 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 769 a.a.        Molecular weight: 85571.58 Da        Isoelectric Point: 5.1733

>WP_009309880.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPEPVSQPA
PAVMTVTPAPVKSPPTTKRPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAGTAATASSAGTPAAAAGGTE
QVLAQQSAEQGQAMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDLEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 31343..59432

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PTC90_RS31500 (PTC90_31495) 26525..26872 + 348 WP_273863580 hypothetical protein -
PTC90_RS31505 (PTC90_31500) 26965..27111 + 147 WP_022644943 hypothetical protein -
PTC90_RS31510 (PTC90_31505) 27159..27395 + 237 Protein_39 SAM-dependent DNA methyltransferase -
PTC90_RS31515 (PTC90_31510) 27369..27551 - 183 WP_071562612 hypothetical protein -
PTC90_RS31520 (PTC90_31515) 27744..28286 + 543 WP_022644941 antirestriction protein -
PTC90_RS31525 (PTC90_31520) 28310..28792 - 483 WP_022644940 transglycosylase SLT domain-containing protein -
PTC90_RS31530 (PTC90_31525) 29237..29629 + 393 WP_020804860 conjugal transfer relaxosome DNA-binding protein TraM -
PTC90_RS31535 (PTC90_31530) 29867..30559 + 693 WP_032426082 conjugal transfer protein TrbJ -
PTC90_RS31540 (PTC90_31535) 30734..30898 + 165 WP_032426810 TraY domain-containing protein -
PTC90_RS31545 (PTC90_31540) 30961..31329 + 369 WP_040118418 type IV conjugative transfer system pilin TraA -
PTC90_RS31550 (PTC90_31545) 31343..31648 + 306 WP_020323523 type IV conjugative transfer system protein TraL traL
PTC90_RS31555 (PTC90_31550) 31668..32234 + 567 WP_040118472 type IV conjugative transfer system protein TraE traE
PTC90_RS31560 (PTC90_31555) 32221..32961 + 741 WP_040118473 type-F conjugative transfer system secretin TraK traK
PTC90_RS31565 (PTC90_31560) 32961..34376 + 1416 WP_040118474 F-type conjugal transfer pilus assembly protein TraB traB
PTC90_RS31570 (PTC90_31565) 34369..34965 + 597 WP_117146400 conjugal transfer protein TraP -
PTC90_RS31575 (PTC90_31570) 35205..35786 + 582 WP_040118475 type IV conjugative transfer system lipoprotein TraV traV
PTC90_RS31580 (PTC90_31575) 35933..36136 + 204 WP_020315141 hypothetical protein -
PTC90_RS31585 (PTC90_31580) 36377..36790 + 414 WP_040118476 hypothetical protein -
PTC90_RS31590 (PTC90_31585) 36819..37118 + 300 WP_040118477 hypothetical protein -
PTC90_RS31595 (PTC90_31590) 37135..37359 + 225 WP_040118478 hypothetical protein -
PTC90_RS31600 (PTC90_31595) 37356..37760 + 405 WP_040118479 hypothetical protein -
PTC90_RS31605 (PTC90_31600) 37893..40532 + 2640 WP_040118480 type IV secretion system protein TraC virb4
PTC90_RS31610 (PTC90_31605) 40565..40966 + 402 WP_051800694 type-F conjugative transfer system protein TrbI -
PTC90_RS31615 (PTC90_31610) 40963..41589 + 627 WP_040118481 type-F conjugative transfer system protein TraW traW
PTC90_RS31620 (PTC90_31615) 41609..42592 + 984 WP_273863590 conjugal transfer pilus assembly protein TraU traU
PTC90_RS31625 (PTC90_31620) 42607..43155 + 549 WP_022631518 hypothetical protein -
PTC90_RS31630 (PTC90_31625) 43876..44478 + 603 WP_022631520 hypothetical protein -
PTC90_RS31635 (PTC90_31630) 44623..45270 + 648 WP_273863541 type-F conjugative transfer system pilin assembly protein TrbC trbC
PTC90_RS31640 (PTC90_31635) 45329..47284 + 1956 WP_020803160 type-F conjugative transfer system mating-pair stabilization protein TraN traN
PTC90_RS31645 (PTC90_31640) 47317..47598 + 282 WP_032419932 hypothetical protein -
PTC90_RS31650 (PTC90_31645) 47588..47815 + 228 WP_012540032 conjugal transfer protein TrbE -
PTC90_RS31655 (PTC90_31650) 47826..48152 + 327 WP_020323521 hypothetical protein -
PTC90_RS31660 (PTC90_31655) 48173..48925 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
PTC90_RS31665 (PTC90_31660) 48936..49175 + 240 WP_009309875 type-F conjugative transfer system pilin chaperone TraQ -
PTC90_RS31670 (PTC90_31665) 49147..49719 + 573 WP_009309876 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
PTC90_RS31675 (PTC90_31670) 49712..50140 + 429 WP_004152689 hypothetical protein -
PTC90_RS31680 (PTC90_31675) 50127..51497 + 1371 WP_009309877 conjugal transfer pilus assembly protein TraH traH
PTC90_RS31685 (PTC90_31680) 51497..54370 + 2874 WP_009309878 conjugal transfer mating-pair stabilization protein TraG traG
PTC90_RS31690 (PTC90_31685) 55030..56010 + 981 WP_000019445 IS5-like element ISKpn26 family transposase -
PTC90_RS32910 55992..56207 + 216 WP_337961636 hypothetical protein -
PTC90_RS31695 (PTC90_31690) 56305..56997 + 693 WP_009309879 hypothetical protein -
PTC90_RS31700 (PTC90_31695) 57123..59432 + 2310 WP_009309880 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   4560 GenBank   NZ_CP117734
Plasmid name   2022CK-00781|unnamed4 Incompatibility group   -
Plasmid size   69985 bp Coordinate of oriT [Strand]   28877..28925 [-]
Host baterium   Klebsiella grimontii strain 2022CK-00781

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -