Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104114 |
| Name | oriT_DS-1|unnamed3 |
| Organism | Klebsiella pneumoniae strain DS-1 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP117484 (64384..64433 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_DS-1|unnamed3
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2918 | GenBank | WP_245199962 |
| Name | traD_PPH92_RS27375_DS-1|unnamed3 |
UniProt ID | _ |
| Length | 769 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 769 a.a. Molecular weight: 85868.92 Da Isoelectric Point: 5.2532
>WP_245199962.1 type IV conjugative transfer system coupling protein TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTVWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARTLFMPDAPASGPADTNSHAGEQPEPISQPA
PADMTVSPAPVKAPPTTKSPAAEPSVRATEPPVLRVTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDARADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTVWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARTLFMPDAPASGPADTNSHAGEQPEPISQPA
PADMTVSPAPVKAPPTTKSPAAEPSVRATEPPVLRVTTVPLIKPKAAAAATAASTASSAGAPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDARADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 63826..83495
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPH92_RS27650 (PPH92_27650) | 58841..59161 | + | 321 | WP_273857233 | hypothetical protein | - |
| PPH92_RS27655 (PPH92_27655) | 59834..60190 | + | 357 | WP_019706019 | hypothetical protein | - |
| PPH92_RS27660 (PPH92_27660) | 60251..60463 | + | 213 | WP_019706020 | hypothetical protein | - |
| PPH92_RS27665 (PPH92_27665) | 60474..60698 | + | 225 | WP_014343499 | hypothetical protein | - |
| PPH92_RS27670 (PPH92_27670) | 60779..61099 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PPH92_RS27675 (PPH92_27675) | 61089..61367 | + | 279 | WP_032411288 | helix-turn-helix transcriptional regulator | - |
| PPH92_RS27680 (PPH92_27680) | 61368..61781 | + | 414 | WP_032411285 | helix-turn-helix domain-containing protein | - |
| PPH92_RS27685 (PPH92_27685) | 62610..63431 | + | 822 | WP_004182076 | DUF932 domain-containing protein | - |
| PPH92_RS27690 (PPH92_27690) | 63464..63793 | + | 330 | WP_032420969 | DUF5983 family protein | - |
| PPH92_RS27695 (PPH92_27695) | 63826..64311 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
| PPH92_RS27700 (PPH92_27700) | 64746..65138 | + | 393 | WP_032436755 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PPH92_RS27705 (PPH92_27705) | 65345..66040 | + | 696 | WP_023307551 | transcriptional regulator TraJ family protein | - |
| PPH92_RS27710 (PPH92_27710) | 66124..66495 | + | 372 | WP_004208838 | TraY domain-containing protein | - |
| PPH92_RS27715 (PPH92_27715) | 66549..66917 | + | 369 | WP_023307550 | type IV conjugative transfer system pilin TraA | - |
| PPH92_RS27720 (PPH92_27720) | 66931..67236 | + | 306 | WP_004178059 | type IV conjugative transfer system protein TraL | traL |
| PPH92_RS27725 (PPH92_27725) | 67256..67822 | + | 567 | WP_004152602 | type IV conjugative transfer system protein TraE | traE |
| PPH92_RS27730 (PPH92_27730) | 67809..68549 | + | 741 | WP_004152497 | type-F conjugative transfer system secretin TraK | traK |
| PPH92_RS27735 (PPH92_27735) | 68549..69973 | + | 1425 | WP_023307549 | F-type conjugal transfer pilus assembly protein TraB | traB |
| PPH92_RS27740 (PPH92_27740) | 69966..70385 | + | 420 | Protein_78 | conjugal transfer pilus-stabilizing protein TraP | - |
| PPH92_RS27745 (PPH92_27745) | 70597..71166 | + | 570 | WP_023307547 | type IV conjugative transfer system lipoprotein TraV | traV |
| PPH92_RS27750 (PPH92_27750) | 71298..71708 | + | 411 | WP_023307546 | hypothetical protein | - |
| PPH92_RS27755 (PPH92_27755) | 71713..72003 | + | 291 | WP_032423381 | hypothetical protein | - |
| PPH92_RS27760 (PPH92_27760) | 72027..72245 | + | 219 | WP_004171484 | hypothetical protein | - |
| PPH92_RS27765 (PPH92_27765) | 72246..72563 | + | 318 | WP_023307544 | hypothetical protein | - |
| PPH92_RS27770 (PPH92_27770) | 72630..73034 | + | 405 | WP_023307543 | hypothetical protein | - |
| PPH92_RS27775 (PPH92_27775) | 73031..73321 | + | 291 | WP_023307542 | hypothetical protein | - |
| PPH92_RS27780 (PPH92_27780) | 73329..73727 | + | 399 | WP_072158599 | hypothetical protein | - |
| PPH92_RS27785 (PPH92_27785) | 73799..76438 | + | 2640 | WP_117059329 | type IV secretion system protein TraC | virb4 |
| PPH92_RS27790 (PPH92_27790) | 76438..76827 | + | 390 | WP_032436749 | type-F conjugative transfer system protein TrbI | - |
| PPH92_RS27795 (PPH92_27795) | 76827..77453 | + | 627 | WP_023307538 | type-F conjugative transfer system protein TraW | traW |
| PPH92_RS27800 (PPH92_27800) | 77497..78456 | + | 960 | WP_015065634 | conjugal transfer pilus assembly protein TraU | traU |
| PPH92_RS27805 (PPH92_27805) | 78469..79107 | + | 639 | WP_015065635 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| PPH92_RS27810 (PPH92_27810) | 79166..81121 | + | 1956 | WP_273857250 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| PPH92_RS27815 (PPH92_27815) | 81153..81389 | + | 237 | WP_023292149 | conjugal transfer protein TrbE | - |
| PPH92_RS27950 | 81386..81571 | + | 186 | WP_004152684 | hypothetical protein | - |
| PPH92_RS27820 (PPH92_27820) | 81617..81943 | + | 327 | WP_004152685 | hypothetical protein | - |
| PPH92_RS27825 (PPH92_27825) | 81964..82716 | + | 753 | WP_004152686 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| PPH92_RS27830 (PPH92_27830) | 82727..82966 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
| PPH92_RS27835 (PPH92_27835) | 82938..83495 | + | 558 | WP_004152678 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| PPH92_RS27840 (PPH92_27840) | 83540..83983 | + | 444 | WP_032436741 | F-type conjugal transfer protein TrbF | - |
Host bacterium
| ID | 4553 | GenBank | NZ_CP117484 |
| Plasmid name | DS-1|unnamed3 | Incompatibility group | IncFIB |
| Plasmid size | 85339 bp | Coordinate of oriT [Strand] | 64384..64433 [-] |
| Host baterium | Klebsiella pneumoniae strain DS-1 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |