Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104109
Name   oriT_pEA22_3 in_silico
Organism   Escherichia albertii strain BIA_22
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117631 (48212..48563 [+], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      260..268, 279..287  (CAGGGGCGC..GCGCCCCTG)
 192..198, 206..212  (TATAAAA..TTTTATA)
 104..110, 118..124  (TTTAAAT..ATTTAAA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_pEA22_3
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTATCTTTAATATCATTGAGTTGTATTTGTGGATTTATATTGTTTAAATTTGATTTATTTAAAGCAGCGTCGTTAACGCAGCTACAGCAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGTCAGGGGCGCTGCTAGCGGTGCGCCCCTGTTTGCACTATGAATTCTAGTGTTTCGAAATTAACTTTGTTTTATGTTTAAAAAAGGTAATATCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2915 GenBank   WP_181668576
Name   traC_PS041_RS26120_pEA22_3 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99144.73 Da        Isoelectric Point: 5.7326

>WP_181668576.1 MULTISPECIES: type IV secretion system protein TraC [Escherichia]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
AGGTYGRYFNSDEPSLQDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-771)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.



ID   2916 GenBank   WP_273825582
Name   traD_PS041_RS26220_pEA22_3 insolico UniProt ID   _
Length   741 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 741 a.a.        Molecular weight: 84418.25 Da        Isoelectric Point: 5.1083

>WP_273825582.1 type IV conjugative transfer system coupling protein TraD [Escherichia albertii]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVSTGKSEVIRRLANYAR
KRGDMVVIYDRSCEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNVANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTYLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMVSLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMA
AYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 47641..74869

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS26020 (PS041_26020) 42700..42933 + 234 WP_071588969 hypothetical protein -
PS041_RS26025 (PS041_26025) 43174..43434 + 261 WP_042046747 hypothetical protein -
PS041_RS26030 (PS041_26030) 43551..44537 - 987 WP_273810655 IS110 family transposase -
PS041_RS26040 (PS041_26040) 46118..46405 + 288 WP_000107535 hypothetical protein -
PS041_RS26045 (PS041_26045) 46523..47344 + 822 WP_001234426 DUF932 domain-containing protein -
PS041_RS26050 (PS041_26050) 47641..48288 - 648 WP_155953419 transglycosylase SLT domain-containing protein virB1
PS041_RS26055 (PS041_26055) 48564..48947 + 384 WP_001151530 conjugal transfer relaxosome DNA-binding protein TraM -
PS041_RS26060 (PS041_26060) 49139..49786 + 648 WP_096040777 transcriptional regulator TraJ family protein -
PS041_RS26065 (PS041_26065) 49906..50133 + 228 WP_000589558 conjugal transfer relaxosome protein TraY -
PS041_RS26070 (PS041_26070) 50167..50559 + 393 WP_024127870 type IV conjugative transfer system pilin TraA -
PS041_RS26075 (PS041_26075) 50574..50885 + 312 WP_001585108 type IV conjugative transfer system protein TraL traL
PS041_RS26080 (PS041_26080) 50907..51473 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
PS041_RS26085 (PS041_26085) 51460..52188 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
PS041_RS26090 (PS041_26090) 52188..53615 + 1428 WP_273825561 F-type conjugal transfer pilus assembly protein TraB traB
PS041_RS26095 (PS041_26095) 53605..54195 + 591 WP_001376242 conjugal transfer pilus-stabilizing protein TraP -
PS041_RS26100 (PS041_26100) 54182..54379 + 198 WP_001324648 conjugal transfer protein TrbD -
PS041_RS26105 (PS041_26105) 54392..54643 + 252 WP_001038341 conjugal transfer protein TrbG -
PS041_RS26110 (PS041_26110) 54640..55155 + 516 WP_016241856 type IV conjugative transfer system lipoprotein TraV traV
PS041_RS26115 (PS041_26115) 55290..55511 + 222 WP_001278685 conjugal transfer protein TraR -
PS041_RS26120 (PS041_26120) 55671..58298 + 2628 WP_181668576 type IV secretion system protein TraC virb4
PS041_RS26125 (PS041_26125) 58295..58681 + 387 WP_181668575 type-F conjugative transfer system protein TrbI -
PS041_RS26130 (PS041_26130) 58678..59310 + 633 WP_001203749 type-F conjugative transfer system protein TraW traW
PS041_RS26135 (PS041_26135) 59307..60299 + 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
PS041_RS26140 (PS041_26140) 60325..60789 + 465 WP_096948751 hypothetical protein -
PS041_RS26145 (PS041_26145) 60800..61115 + 316 Protein_81 hypothetical protein -
PS041_RS26150 (PS041_26150) 61108..61560 + 453 WP_001349502 hypothetical protein -
PS041_RS26155 (PS041_26155) 61588..62226 + 639 WP_273810593 type-F conjugative transfer system pilin assembly protein TrbC trbC
PS041_RS26160 (PS041_26160) 62223..64031 + 1809 WP_273810592 type-F conjugative transfer system mating-pair stabilization protein TraN traN
PS041_RS26165 (PS041_26165) 64058..64315 + 258 WP_000864318 conjugal transfer protein TrbE -
PS041_RS26170 (PS041_26170) 64308..65051 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
PS041_RS26175 (PS041_26175) 65067..65414 + 348 WP_001287677 conjugal transfer protein TrbA -
PS041_RS26180 (PS041_26180) 65416..65730 - 315 WP_000415566 protein ArtA -
PS041_RS26185 (PS041_26185) 65811..66095 + 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
PS041_RS26190 (PS041_26190) 66082..66627 + 546 WP_000059833 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
PS041_RS26195 (PS041_26195) 66557..66919 + 363 WP_174491168 P-type conjugative transfer protein TrbJ -
PS041_RS26200 (PS041_26200) 66919..68292 + 1374 WP_001137358 conjugal transfer pilus assembly protein TraH traH
PS041_RS26205 (PS041_26205) 68289..71111 + 2823 WP_273810591 conjugal transfer mating-pair stabilization protein TraG traG
PS041_RS26210 (PS041_26210) 71126..71629 + 504 WP_000605510 hypothetical protein -
PS041_RS26215 (PS041_26215) 71661..72392 + 732 WP_000850424 conjugal transfer complement resistance protein TraT -
PS041_RS26220 (PS041_26220) 72644..74869 + 2226 WP_273825582 type IV conjugative transfer system coupling protein TraD prgC

Host bacterium

ID   4548 GenBank   NZ_CP117631
Plasmid name   pEA22_3 Incompatibility group   -
Plasmid size   84891 bp Coordinate of oriT [Strand]   48212..48563 [+]
Host baterium   Escherichia albertii strain BIA_22

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -