Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104108
Name   oriT_pEA22_1 in_silico
Organism   Escherichia albertii strain BIA_22
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117629 (124470..124821 [-], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      260..268, 279..287  (CAGGGGCGC..GCGCCCCTG)
 192..198, 206..212  (TATAAAA..TTTTATA)
 104..110, 118..124  (TTTAAAT..ATTTAAA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_pEA22_1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTATCTTTAATATCATTGAGTTGTATTTGTGGATTTATATTGTTTAAATTTGATTTATTTAAAGCAGCGTCGTTAACGCAGCTACAGCAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGTCAGGGGCGCTGCTAGCGGTGCGCCCCTGTTTGCACTATGAATTCTAGTGTTTCGAAATTAACTTTGTTTTATGTTTAAAAAAGGTAATATCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2913 GenBank   WP_169004911
Name   traD_PS041_RS24915_pEA22_1 insolico UniProt ID   _
Length   750 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 750 a.a.        Molecular weight: 85350.11 Da        Isoelectric Point: 5.0504

>WP_169004911.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Escherichia]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPQQPQQPQQPVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGIS
ESGEVVDMAAYEAWQQENHPDIQQQMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

F sex factor protein N terminal (TraD_N)

(32-128)

  Protein structure



No available structure.



ID   2914 GenBank   WP_181668576
Name   traC_PS041_RS25015_pEA22_1 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99144.73 Da        Isoelectric Point: 5.7326

>WP_181668576.1 MULTISPECIES: type IV secretion system protein TraC [Escherichia]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
AGGTYGRYFNSDEPSLQDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraG P-loop domain (P-loop_TraG)

(467-771)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

TraC protein (TraC_F_IV)

(38-276)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 98163..125392

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS041_RS24915 (PS041_24915) 98163..100415 - 2253 WP_169004911 type IV conjugative transfer system coupling protein TraD virb4
PS041_RS24920 (PS041_24920) 100668..101399 - 732 WP_000850424 conjugal transfer complement resistance protein TraT -
PS041_RS24925 (PS041_24925) 101413..101922 - 510 WP_021559023 conjugal transfer entry exclusion protein TraS -
PS041_RS24930 (PS041_24930) 101919..104744 - 2826 WP_273825560 conjugal transfer mating-pair stabilization protein TraG traG
PS041_RS24935 (PS041_24935) 104741..106114 - 1374 WP_001137358 conjugal transfer pilus assembly protein TraH traH
PS041_RS24940 (PS041_24940) 106114..106476 - 363 WP_174491168 P-type conjugative transfer protein TrbJ -
PS041_RS24945 (PS041_24945) 106406..106951 - 546 WP_000059833 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
PS041_RS24950 (PS041_24950) 106938..107222 - 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
PS041_RS24955 (PS041_24955) 107303..107617 + 315 WP_000415566 protein ArtA -
PS041_RS24960 (PS041_24960) 107619..107966 - 348 WP_042973381 conjugal transfer protein TrbA -
PS041_RS24965 (PS041_24965) 107982..108725 - 744 WP_001030378 type-F conjugative transfer system pilin assembly protein TraF traF
PS041_RS24970 (PS041_24970) 108718..108975 - 258 WP_000864318 conjugal transfer protein TrbE -
PS041_RS24975 (PS041_24975) 109002..110810 - 1809 WP_273810592 type-F conjugative transfer system mating-pair stabilization protein TraN traN
PS041_RS24980 (PS041_24980) 110807..111445 - 639 WP_273810593 type-F conjugative transfer system pilin assembly protein TrbC trbC
PS041_RS24985 (PS041_24985) 111473..111925 - 453 WP_001349502 hypothetical protein -
PS041_RS24990 (PS041_24990) 111918..112233 - 316 Protein_119 hypothetical protein -
PS041_RS24995 (PS041_24995) 112244..112708 - 465 WP_096948751 hypothetical protein -
PS041_RS25000 (PS041_25000) 112734..113726 - 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
PS041_RS25005 (PS041_25005) 113723..114355 - 633 WP_001203749 type-F conjugative transfer system protein TraW traW
PS041_RS25010 (PS041_25010) 114352..114738 - 387 WP_181668575 type-F conjugative transfer system protein TrbI -
PS041_RS25015 (PS041_25015) 114735..117362 - 2628 WP_181668576 type IV secretion system protein TraC virb4
PS041_RS25020 (PS041_25020) 117522..117743 - 222 WP_001278685 conjugal transfer protein TraR -
PS041_RS25025 (PS041_25025) 117878..118393 - 516 WP_016241856 type IV conjugative transfer system lipoprotein TraV traV
PS041_RS25030 (PS041_25030) 118390..118641 - 252 WP_001038341 conjugal transfer protein TrbG -
PS041_RS25035 (PS041_25035) 118654..118851 - 198 WP_001324648 conjugal transfer protein TrbD -
PS041_RS25040 (PS041_25040) 118838..119428 - 591 WP_001376242 conjugal transfer pilus-stabilizing protein TraP -
PS041_RS25045 (PS041_25045) 119418..120845 - 1428 WP_273825561 F-type conjugal transfer pilus assembly protein TraB traB
PS041_RS25050 (PS041_25050) 120845..121573 - 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
PS041_RS25055 (PS041_25055) 121560..122126 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
PS041_RS25060 (PS041_25060) 122148..122459 - 312 WP_001585108 type IV conjugative transfer system protein TraL traL
PS041_RS25065 (PS041_25065) 122474..122866 - 393 WP_024127870 type IV conjugative transfer system pilin TraA -
PS041_RS25070 (PS041_25070) 122900..123127 - 228 WP_000589558 conjugal transfer relaxosome protein TraY -
PS041_RS25075 (PS041_25075) 123247..123894 - 648 WP_096040777 transcriptional regulator TraJ family protein -
PS041_RS25080 (PS041_25080) 124086..124469 - 384 WP_001151530 conjugal transfer relaxosome DNA-binding protein TraM -
PS041_RS25085 (PS041_25085) 124745..125392 + 648 WP_155953419 transglycosylase SLT domain-containing protein virB1
PS041_RS25090 (PS041_25090) 125689..126510 - 822 WP_001234426 DUF932 domain-containing protein -
PS041_RS25095 (PS041_25095) 126628..126915 - 288 WP_000107535 hypothetical protein -
PS041_RS25100 (PS041_25100) 127290..128518 + 1229 WP_273809172 IS3-like element IS2 family transposase -
PS041_RS25105 (PS041_25105) 128496..129482 + 987 WP_273810655 IS110 family transposase -
PS041_RS25110 (PS041_25110) 129599..129859 - 261 WP_062858058 hypothetical protein -
PS041_RS25115 (PS041_25115) 129929..130009 + 81 Protein_144 hypothetical protein -
PS041_RS25120 (PS041_25120) 130192..130361 - 170 Protein_145 hypothetical protein -

Host bacterium

ID   4547 GenBank   NZ_CP117629
Plasmid name   pEA22_1 Incompatibility group   IncFIB
Plasmid size   152064 bp Coordinate of oriT [Strand]   124470..124821 [-]
Host baterium   Escherichia albertii strain BIA_22

Cargo genes

Drug resistance gene   sitABCD
Virulence gene   vat, iutA, iucC, iucB, iucA
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -