Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104097
Name   oriT_pEA7_3 in_silico
Organism   Escherichia albertii strain BIA_7
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117565 (15308..15360 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pEA7_3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2906 GenBank   WP_273820580
Name   t4cp2_PS049_RS26515_pEA7_3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73540.19 Da        Isoelectric Point: 9.2434

>WP_273820580.1 type IV secretory system conjugative DNA transfer family protein [Escherichia albertii]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVITTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVAIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILVPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKKELMDKIAKDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 33911..56786

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS049_RS26455 (PS049_26455) 29058..29711 - 654 WP_273820632 hypothetical protein -
PS049_RS26460 (PS049_26460) 29723..30847 - 1125 WP_101687407 site-specific integrase -
PS049_RS26465 (PS049_26465) 31183..31446 - 264 WP_230138875 hypothetical protein -
PS049_RS26470 (PS049_26470) 31883..33259 - 1377 WP_273820569 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
PS049_RS26475 (PS049_26475) 33272..33907 - 636 WP_025380733 A24 family peptidase -
PS049_RS26480 (PS049_26480) 33911..34393 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
PS049_RS26485 (PS049_26485) 34459..35016 - 558 WP_000095048 type 4 pilus major pilin -
PS049_RS26490 (PS049_26490) 35061..36170 - 1110 WP_000974903 type II secretion system F family protein -
PS049_RS26495 (PS049_26495) 36161..37699 - 1539 WP_000466227 ATPase, T2SS/T4P/T4SS family virB11
PS049_RS26500 (PS049_26500) 37724..38218 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
PS049_RS26505 (PS049_26505) 38202..39512 - 1311 WP_001454111 type 4b pilus protein PilO2 -
PS049_RS26510 (PS049_26510) 39563..41206 - 1644 WP_273820578 PilN family type IVB pilus formation outer membrane protein -
PS049_RS26515 (PS049_26515) 41257..43215 - 1959 WP_273820580 type IV secretory system conjugative DNA transfer family protein -
PS049_RS26520 (PS049_26520) 43231..44286 - 1056 WP_151333052 P-type DNA transfer ATPase VirB11 virB11
PS049_RS26525 (PS049_26525) 44305..45444 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
PS049_RS26530 (PS049_26530) 45434..46135 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
PS049_RS26535 (PS049_26535) 46201..46935 - 735 WP_000432282 type IV secretion system protein virB8
PS049_RS26540 (PS049_26540) 47101..49458 - 2358 WP_266195087 conjugal transfer protein virb4
PS049_RS26545 (PS049_26545) 49464..49784 - 321 WP_062897953 VirB3 family type IV secretion system protein virB3
PS049_RS26550 (PS049_26550) 49855..50145 - 291 WP_000865478 TrbC/VirB2 family protein virB2
PS049_RS26555 (PS049_26555) 50145..50729 - 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
PS049_RS26560 (PS049_26560) 50750..51148 - 399 WP_001153669 hypothetical protein -
PS049_RS26565 (PS049_26565) 51267..51704 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
PS049_RS26570 (PS049_26570) 51710..52945 - 1236 WP_021580486 TcpQ domain-containing protein -
PS049_RS26575 (PS049_26575) 52948..53247 - 300 WP_000835774 TrbM/KikA/MpfK family conjugal transfer protein -
PS049_RS26580 (PS049_26580) 53314..53949 - 636 WP_000835767 hypothetical protein -
PS049_RS26585 (PS049_26585) 53997..54788 + 792 WP_022645137 DUF5710 domain-containing protein -
PS049_RS26590 (PS049_26590) 54896..55141 - 246 WP_063080371 EexN family lipoprotein -
PS049_RS26595 (PS049_26595) 55141..55782 - 642 WP_062897948 type IV secretion system protein -
PS049_RS26600 (PS049_26600) 55788..56786 - 999 WP_062897947 type IV secretion system protein virB6
PS049_RS26605 (PS049_26605) 56790..57047 - 258 WP_000739144 hypothetical protein -
PS049_RS26610 (PS049_26610) 57044..57346 - 303 WP_062897946 hypothetical protein -
PS049_RS26615 (PS049_26615) 57849..58502 - 654 WP_062897944 hypothetical protein -
PS049_RS26620 (PS049_26620) 58513..58683 - 171 WP_000550721 hypothetical protein -
PS049_RS26625 (PS049_26625) 58687..59130 - 444 WP_000964333 NfeD family protein -
PS049_RS26630 (PS049_26630) 59522..60475 - 954 WP_072097371 SPFH domain-containing protein -
PS049_RS26635 (PS049_26635) 60502..60678 - 177 WP_170931676 hypothetical protein -
PS049_RS26640 (PS049_26640) 60671..60886 - 216 WP_062897943 DUF1187 family protein -
PS049_RS26645 (PS049_26645) 60879..61331 - 453 WP_223666486 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   4536 GenBank   NZ_CP117565
Plasmid name   pEA7_3 Incompatibility group   IncI2
Plasmid size   62457 bp Coordinate of oriT [Strand]   15308..15360 [-]
Host baterium   Escherichia albertii strain BIA_7

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -