Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 104097 |
Name | oriT_pEA7_3 |
Organism | Escherichia albertii strain BIA_7 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP117565 (15308..15360 [-], 53 nt) |
oriT length | 53 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pEA7_3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 2906 | GenBank | WP_273820580 |
Name | t4cp2_PS049_RS26515_pEA7_3 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73540.19 Da Isoelectric Point: 9.2434
>WP_273820580.1 type IV secretory system conjugative DNA transfer family protein [Escherichia albertii]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVITTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVAIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILVPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKKELMDKIAKDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVITTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVAIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILVPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNPVEIPLLFKDKKELMDKIAKDAEIYLSDQKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33911..56786
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS049_RS26455 (PS049_26455) | 29058..29711 | - | 654 | WP_273820632 | hypothetical protein | - |
PS049_RS26460 (PS049_26460) | 29723..30847 | - | 1125 | WP_101687407 | site-specific integrase | - |
PS049_RS26465 (PS049_26465) | 31183..31446 | - | 264 | WP_230138875 | hypothetical protein | - |
PS049_RS26470 (PS049_26470) | 31883..33259 | - | 1377 | WP_273820569 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
PS049_RS26475 (PS049_26475) | 33272..33907 | - | 636 | WP_025380733 | A24 family peptidase | - |
PS049_RS26480 (PS049_26480) | 33911..34393 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
PS049_RS26485 (PS049_26485) | 34459..35016 | - | 558 | WP_000095048 | type 4 pilus major pilin | - |
PS049_RS26490 (PS049_26490) | 35061..36170 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
PS049_RS26495 (PS049_26495) | 36161..37699 | - | 1539 | WP_000466227 | ATPase, T2SS/T4P/T4SS family | virB11 |
PS049_RS26500 (PS049_26500) | 37724..38218 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
PS049_RS26505 (PS049_26505) | 38202..39512 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
PS049_RS26510 (PS049_26510) | 39563..41206 | - | 1644 | WP_273820578 | PilN family type IVB pilus formation outer membrane protein | - |
PS049_RS26515 (PS049_26515) | 41257..43215 | - | 1959 | WP_273820580 | type IV secretory system conjugative DNA transfer family protein | - |
PS049_RS26520 (PS049_26520) | 43231..44286 | - | 1056 | WP_151333052 | P-type DNA transfer ATPase VirB11 | virB11 |
PS049_RS26525 (PS049_26525) | 44305..45444 | - | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
PS049_RS26530 (PS049_26530) | 45434..46135 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
PS049_RS26535 (PS049_26535) | 46201..46935 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
PS049_RS26540 (PS049_26540) | 47101..49458 | - | 2358 | WP_266195087 | conjugal transfer protein | virb4 |
PS049_RS26545 (PS049_26545) | 49464..49784 | - | 321 | WP_062897953 | VirB3 family type IV secretion system protein | virB3 |
PS049_RS26550 (PS049_26550) | 49855..50145 | - | 291 | WP_000865478 | TrbC/VirB2 family protein | virB2 |
PS049_RS26555 (PS049_26555) | 50145..50729 | - | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
PS049_RS26560 (PS049_26560) | 50750..51148 | - | 399 | WP_001153669 | hypothetical protein | - |
PS049_RS26565 (PS049_26565) | 51267..51704 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
PS049_RS26570 (PS049_26570) | 51710..52945 | - | 1236 | WP_021580486 | TcpQ domain-containing protein | - |
PS049_RS26575 (PS049_26575) | 52948..53247 | - | 300 | WP_000835774 | TrbM/KikA/MpfK family conjugal transfer protein | - |
PS049_RS26580 (PS049_26580) | 53314..53949 | - | 636 | WP_000835767 | hypothetical protein | - |
PS049_RS26585 (PS049_26585) | 53997..54788 | + | 792 | WP_022645137 | DUF5710 domain-containing protein | - |
PS049_RS26590 (PS049_26590) | 54896..55141 | - | 246 | WP_063080371 | EexN family lipoprotein | - |
PS049_RS26595 (PS049_26595) | 55141..55782 | - | 642 | WP_062897948 | type IV secretion system protein | - |
PS049_RS26600 (PS049_26600) | 55788..56786 | - | 999 | WP_062897947 | type IV secretion system protein | virB6 |
PS049_RS26605 (PS049_26605) | 56790..57047 | - | 258 | WP_000739144 | hypothetical protein | - |
PS049_RS26610 (PS049_26610) | 57044..57346 | - | 303 | WP_062897946 | hypothetical protein | - |
PS049_RS26615 (PS049_26615) | 57849..58502 | - | 654 | WP_062897944 | hypothetical protein | - |
PS049_RS26620 (PS049_26620) | 58513..58683 | - | 171 | WP_000550721 | hypothetical protein | - |
PS049_RS26625 (PS049_26625) | 58687..59130 | - | 444 | WP_000964333 | NfeD family protein | - |
PS049_RS26630 (PS049_26630) | 59522..60475 | - | 954 | WP_072097371 | SPFH domain-containing protein | - |
PS049_RS26635 (PS049_26635) | 60502..60678 | - | 177 | WP_170931676 | hypothetical protein | - |
PS049_RS26640 (PS049_26640) | 60671..60886 | - | 216 | WP_062897943 | DUF1187 family protein | - |
PS049_RS26645 (PS049_26645) | 60879..61331 | - | 453 | WP_223666486 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
ID | 4536 | GenBank | NZ_CP117565 |
Plasmid name | pEA7_3 | Incompatibility group | IncI2 |
Plasmid size | 62457 bp | Coordinate of oriT [Strand] | 15308..15360 [-] |
Host baterium | Escherichia albertii strain BIA_7 |
Cargo genes
Drug resistance gene | - |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |