Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104092
Name   oriT_pEA26_2 in_silico
Organism   Escherichia albertii strain BIA_26
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117611 (26229..26580 [+], 352 nt)
oriT length   352 nt
IRs (inverted repeats)      255..262, 271..278  (ACCGCTAG..CTAGCGGT)
 192..198, 206..212  (TATAAAA..TTTTATA)
 40..47, 50..57  (GCAAAAAC..GTTTTTGC)
 4..11, 16..23  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 352 nt

>oriT_pEA26_2
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGTGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTCTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1289 GenBank   WP_001151524
Name   WP_001151524_pEA26_2 insolico UniProt ID   A0A5W2DT22
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14517.48 Da        Isoelectric Point: 5.0516

>WP_001151524.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A5W2DT22

ID   1290 GenBank   WP_001369361
Name   WP_001369361_pEA26_2 insolico UniProt ID   B7LI64
Length   133 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 133 a.a.        Molecular weight: 15409.70 Da        Isoelectric Point: 9.9240

>WP_001369361.1 MULTISPECIES: conjugal transfer relaxosome DNA-bindin protein TraY [Gammaproteobacteria]
MLLKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVK
YLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(18-61)

TraY domain (TraY)

(72-119)


  Protein structure


Source ID Structure
AlphaFold DB B7LI64


T4CP

ID   2904 GenBank   WP_273818354
Name   traC_PS038_RS23170_pEA26_2 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99271.91 Da        Isoelectric Point: 5.8486

>WP_273818354.1 type IV secretion system protein TraC [Escherichia albertii]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMSNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

Family of unknown function (DUF5934) (DUF5934)

(290-447)

TraG P-loop domain (P-loop_TraG)

(469-772)

TraC protein (TraC_F_IV)

(39-277)

  Protein structure



No available structure.



ID   2905 GenBank   WP_156849463
Name   traD_PS038_RS23280_pEA26_2 insolico UniProt ID   _
Length   723 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 723 a.a.        Molecular weight: 82207.80 Da        Isoelectric Point: 5.0504

>WP_156849463.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Escherichia]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMVSLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQ
RREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(173-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 25658..58145

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS038_RS23040 (PS038_23040) 20736..22097 + 1362 WP_273818339 DUF3560 domain-containing protein -
PS038_RS23045 (PS038_23045) 22144..22707 + 564 WP_063501375 class I SAM-dependent methyltransferase -
PS038_RS23050 (PS038_23050) 22856..23173 + 318 WP_273818340 hypothetical protein -
PS038_RS23055 (PS038_23055) 23297..23491 + 195 WP_273818368 hypothetical protein -
PS038_RS23060 (PS038_23060) 23565..23789 - 225 WP_172905820 hypothetical protein -
PS038_RS23065 (PS038_23065) 23902..24108 + 207 WP_273818341 single-stranded DNA-binding protein -
PS038_RS23070 (PS038_23070) 24133..24420 + 288 WP_273818342 hypothetical protein -
PS038_RS23075 (PS038_23075) 24540..25361 + 822 WP_001234469 DUF932 domain-containing protein -
PS038_RS23080 (PS038_23080) 25658..26248 - 591 WP_000252680 transglycosylase SLT domain-containing protein -
PS038_RS23085 (PS038_23085) 26581..26964 + 384 WP_001151524 conjugal transfer relaxosome DNA-binding protein TraM -
PS038_RS23090 (PS038_23090) 27151..27840 + 690 WP_273818343 conjugal transfer transcriptional regulator TraJ -
PS038_RS23095 (PS038_23095) 27939..28334 + 396 WP_001309237 conjugal transfer relaxosome DNA-bindin protein TraY -
PS038_RS23100 (PS038_23100) 28367..28732 + 366 WP_273818344 type IV conjugative transfer system pilin TraA -
PS038_RS23105 (PS038_23105) 28747..29058 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
PS038_RS23110 (PS038_23110) 29080..29646 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
PS038_RS23115 (PS038_23115) 29633..30361 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
PS038_RS23120 (PS038_23120) 30361..31788 + 1428 WP_000146657 F-type conjugal transfer pilus assembly protein TraB traB
PS038_RS23125 (PS038_23125) 31778..32368 + 591 WP_273818346 conjugal transfer pilus-stabilizing protein TraP -
PS038_RS23130 (PS038_23130) 32355..32675 + 321 WP_273818347 conjugal transfer protein TrbD -
PS038_RS23135 (PS038_23135) 32672..33187 + 516 WP_273818348 type IV conjugative transfer system lipoprotein TraV traV
PS038_RS23140 (PS038_23140) 33322..33543 + 222 WP_001278695 conjugal transfer protein TraR -
PS038_RS23145 (PS038_23145) 33536..33949 + 414 WP_000549581 hypothetical protein -
PS038_RS23150 (PS038_23150) 33942..34415 + 474 WP_273818349 hypothetical protein -
PS038_RS23155 (PS038_23155) 34495..34710 + 216 WP_273818350 hypothetical protein -
PS038_RS23160 (PS038_23160) 34711..35034 + 324 WP_273818351 hypothetical protein -
PS038_RS23165 (PS038_23165) 35326..35688 + 363 WP_273818352 hypothetical protein -
PS038_RS23170 (PS038_23170) 35814..38444 + 2631 WP_273818354 type IV secretion system protein TraC virb4
PS038_RS23175 (PS038_23175) 38441..38827 + 387 WP_000214082 type-F conjugative transfer system protein TrbI -
PS038_RS23180 (PS038_23180) 38824..39456 + 633 WP_273818355 type-F conjugative transfer system protein TraW traW
PS038_RS23185 (PS038_23185) 39453..40445 + 993 WP_273818357 conjugal transfer pilus assembly protein TraU traU
PS038_RS23190 (PS038_23190) 40474..40785 + 312 WP_273818359 hypothetical protein -
PS038_RS23195 (PS038_23195) 40794..41432 + 639 WP_273818360 type-F conjugative transfer system pilin assembly protein TrbC trbC
PS038_RS23200 (PS038_23200) 41429..41809 + 381 WP_053287535 hypothetical protein -
PS038_RS23205 (PS038_23205) 42045..42725 + 681 Protein_56 conjugal transfer protein TraN -
PS038_RS23210 (PS038_23210) 42813..43835 + 1023 WP_000255944 IS21-like element IS100 family transposase -
PS038_RS23215 (PS038_23215) 43832..44614 + 783 WP_001317493 IS21-like element IS100kyp family helper ATPase IstB -
PS038_RS23220 (PS038_23220) 44742..46361 + 1620 WP_273818010 ISL3-like element ISEc38 family transposase -
PS038_RS23225 (PS038_23225) 46514..47638 + 1125 Protein_60 type-F conjugative transfer system mating-pair stabilization protein TraN -
PS038_RS23230 (PS038_23230) 47665..47922 + 258 WP_273818364 conjugal transfer protein TrbE -
PS038_RS23235 (PS038_23235) 47915..48658 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
PS038_RS23240 (PS038_23240) 48674..49021 + 348 WP_273818361 conjugal transfer protein TrbA -
PS038_RS23245 (PS038_23245) 49140..49424 + 285 WP_000624110 type-F conjugative transfer system pilin chaperone TraQ -
PS038_RS23250 (PS038_23250) 49411..49956 + 546 WP_263781396 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
PS038_RS23255 (PS038_23255) 49886..50248 + 363 WP_273818362 P-type conjugative transfer protein TrbJ -
PS038_RS23260 (PS038_23260) 50248..51621 + 1374 WP_273818365 conjugal transfer pilus assembly protein TraH traH
PS038_RS23265 (PS038_23265) 51618..54440 + 2823 WP_273818363 conjugal transfer mating-pair stabilization protein TraG traG
PS038_RS23270 (PS038_23270) 54456..54941 + 486 WP_000605866 hypothetical protein -
PS038_RS23275 (PS038_23275) 54990..55721 + 732 WP_273818325 conjugal transfer complement resistance protein TraT -
PS038_RS23280 (PS038_23280) 55974..58145 + 2172 WP_156849463 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   4531 GenBank   NZ_CP117611
Plasmid name   pEA26_2 Incompatibility group   IncFIB
Plasmid size   107716 bp Coordinate of oriT [Strand]   26229..26580 [+]
Host baterium   Escherichia albertii strain BIA_26

Cargo genes

Drug resistance gene   -
Virulence gene   vat, espO1-1
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -