Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 104092 |
Name | oriT_pEA26_2 |
Organism | Escherichia albertii strain BIA_26 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP117611 (26229..26580 [+], 352 nt) |
oriT length | 352 nt |
IRs (inverted repeats) | 255..262, 271..278 (ACCGCTAG..CTAGCGGT) 192..198, 206..212 (TATAAAA..TTTTATA) 40..47, 50..57 (GCAAAAAC..GTTTTTGC) 4..11, 16..23 (TTGGTGGT..ACCACCAA) |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 352 nt
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTTTCTTTATAAATAGAGTGTTATGAAAAATTAGTTTCTCTTACTCTCTTTATGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACAACGCGCCGACACCGCTTTGTAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGTGCTGCTAGCGGCGCGGTGTGTTTTTTTATAGGATACCGCTAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTCTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileAuxiliary protein
ID | 1289 | GenBank | WP_001151524 |
Name | WP_001151524_pEA26_2 | UniProt ID | A0A5W2DT22 |
Length | 127 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 127 a.a. Molecular weight: 14517.48 Da Isoelectric Point: 5.0516
MAKVNLYISNDAYEKINAIIEKRRQEGAREKDVSFSATASMLLELGLRVHEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDDE
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5W2DT22 |
ID | 1290 | GenBank | WP_001369361 |
Name | WP_001369361_pEA26_2 | UniProt ID | B7LI64 |
Length | 133 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
Auxiliary protein sequence
Download Length: 133 a.a. Molecular weight: 15409.70 Da Isoelectric Point: 9.9240
MLLKRFGTRSATGKMVKLKLPVDVESLLIEASNRSGRSRSFEAVIRLKDHLHRYPKFNRAGNIYGKSLVK
YLTMRLDDETNQLLIAAKNRSGWCKTDEAADRVIDHLIKFPDFYNSEIFREADKEEDITFNTL
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | B7LI64 |
T4CP
ID | 2904 | GenBank | WP_273818354 |
Name | traC_PS038_RS23170_pEA26_2 | UniProt ID | _ |
Length | 876 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 876 a.a. Molecular weight: 99271.91 Da Isoelectric Point: 5.8486
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMSNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
ID | 2905 | GenBank | WP_156849463 |
Name | traD_PS038_RS23280_pEA26_2 | UniProt ID | _ |
Length | 723 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 723 a.a. Molecular weight: 82207.80 Da Isoelectric Point: 5.0504
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGEPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMVSLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQ
RREEVNINVHRERGEDVEPGDDF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 25658..58145
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PS038_RS23040 (PS038_23040) | 20736..22097 | + | 1362 | WP_273818339 | DUF3560 domain-containing protein | - |
PS038_RS23045 (PS038_23045) | 22144..22707 | + | 564 | WP_063501375 | class I SAM-dependent methyltransferase | - |
PS038_RS23050 (PS038_23050) | 22856..23173 | + | 318 | WP_273818340 | hypothetical protein | - |
PS038_RS23055 (PS038_23055) | 23297..23491 | + | 195 | WP_273818368 | hypothetical protein | - |
PS038_RS23060 (PS038_23060) | 23565..23789 | - | 225 | WP_172905820 | hypothetical protein | - |
PS038_RS23065 (PS038_23065) | 23902..24108 | + | 207 | WP_273818341 | single-stranded DNA-binding protein | - |
PS038_RS23070 (PS038_23070) | 24133..24420 | + | 288 | WP_273818342 | hypothetical protein | - |
PS038_RS23075 (PS038_23075) | 24540..25361 | + | 822 | WP_001234469 | DUF932 domain-containing protein | - |
PS038_RS23080 (PS038_23080) | 25658..26248 | - | 591 | WP_000252680 | transglycosylase SLT domain-containing protein | - |
PS038_RS23085 (PS038_23085) | 26581..26964 | + | 384 | WP_001151524 | conjugal transfer relaxosome DNA-binding protein TraM | - |
PS038_RS23090 (PS038_23090) | 27151..27840 | + | 690 | WP_273818343 | conjugal transfer transcriptional regulator TraJ | - |
PS038_RS23095 (PS038_23095) | 27939..28334 | + | 396 | WP_001309237 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
PS038_RS23100 (PS038_23100) | 28367..28732 | + | 366 | WP_273818344 | type IV conjugative transfer system pilin TraA | - |
PS038_RS23105 (PS038_23105) | 28747..29058 | + | 312 | WP_000012106 | type IV conjugative transfer system protein TraL | traL |
PS038_RS23110 (PS038_23110) | 29080..29646 | + | 567 | WP_000399792 | type IV conjugative transfer system protein TraE | traE |
PS038_RS23115 (PS038_23115) | 29633..30361 | + | 729 | WP_001230787 | type-F conjugative transfer system secretin TraK | traK |
PS038_RS23120 (PS038_23120) | 30361..31788 | + | 1428 | WP_000146657 | F-type conjugal transfer pilus assembly protein TraB | traB |
PS038_RS23125 (PS038_23125) | 31778..32368 | + | 591 | WP_273818346 | conjugal transfer pilus-stabilizing protein TraP | - |
PS038_RS23130 (PS038_23130) | 32355..32675 | + | 321 | WP_273818347 | conjugal transfer protein TrbD | - |
PS038_RS23135 (PS038_23135) | 32672..33187 | + | 516 | WP_273818348 | type IV conjugative transfer system lipoprotein TraV | traV |
PS038_RS23140 (PS038_23140) | 33322..33543 | + | 222 | WP_001278695 | conjugal transfer protein TraR | - |
PS038_RS23145 (PS038_23145) | 33536..33949 | + | 414 | WP_000549581 | hypothetical protein | - |
PS038_RS23150 (PS038_23150) | 33942..34415 | + | 474 | WP_273818349 | hypothetical protein | - |
PS038_RS23155 (PS038_23155) | 34495..34710 | + | 216 | WP_273818350 | hypothetical protein | - |
PS038_RS23160 (PS038_23160) | 34711..35034 | + | 324 | WP_273818351 | hypothetical protein | - |
PS038_RS23165 (PS038_23165) | 35326..35688 | + | 363 | WP_273818352 | hypothetical protein | - |
PS038_RS23170 (PS038_23170) | 35814..38444 | + | 2631 | WP_273818354 | type IV secretion system protein TraC | virb4 |
PS038_RS23175 (PS038_23175) | 38441..38827 | + | 387 | WP_000214082 | type-F conjugative transfer system protein TrbI | - |
PS038_RS23180 (PS038_23180) | 38824..39456 | + | 633 | WP_273818355 | type-F conjugative transfer system protein TraW | traW |
PS038_RS23185 (PS038_23185) | 39453..40445 | + | 993 | WP_273818357 | conjugal transfer pilus assembly protein TraU | traU |
PS038_RS23190 (PS038_23190) | 40474..40785 | + | 312 | WP_273818359 | hypothetical protein | - |
PS038_RS23195 (PS038_23195) | 40794..41432 | + | 639 | WP_273818360 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
PS038_RS23200 (PS038_23200) | 41429..41809 | + | 381 | WP_053287535 | hypothetical protein | - |
PS038_RS23205 (PS038_23205) | 42045..42725 | + | 681 | Protein_56 | conjugal transfer protein TraN | - |
PS038_RS23210 (PS038_23210) | 42813..43835 | + | 1023 | WP_000255944 | IS21-like element IS100 family transposase | - |
PS038_RS23215 (PS038_23215) | 43832..44614 | + | 783 | WP_001317493 | IS21-like element IS100kyp family helper ATPase IstB | - |
PS038_RS23220 (PS038_23220) | 44742..46361 | + | 1620 | WP_273818010 | ISL3-like element ISEc38 family transposase | - |
PS038_RS23225 (PS038_23225) | 46514..47638 | + | 1125 | Protein_60 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
PS038_RS23230 (PS038_23230) | 47665..47922 | + | 258 | WP_273818364 | conjugal transfer protein TrbE | - |
PS038_RS23235 (PS038_23235) | 47915..48658 | + | 744 | WP_001030371 | type-F conjugative transfer system pilin assembly protein TraF | traF |
PS038_RS23240 (PS038_23240) | 48674..49021 | + | 348 | WP_273818361 | conjugal transfer protein TrbA | - |
PS038_RS23245 (PS038_23245) | 49140..49424 | + | 285 | WP_000624110 | type-F conjugative transfer system pilin chaperone TraQ | - |
PS038_RS23250 (PS038_23250) | 49411..49956 | + | 546 | WP_263781396 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
PS038_RS23255 (PS038_23255) | 49886..50248 | + | 363 | WP_273818362 | P-type conjugative transfer protein TrbJ | - |
PS038_RS23260 (PS038_23260) | 50248..51621 | + | 1374 | WP_273818365 | conjugal transfer pilus assembly protein TraH | traH |
PS038_RS23265 (PS038_23265) | 51618..54440 | + | 2823 | WP_273818363 | conjugal transfer mating-pair stabilization protein TraG | traG |
PS038_RS23270 (PS038_23270) | 54456..54941 | + | 486 | WP_000605866 | hypothetical protein | - |
PS038_RS23275 (PS038_23275) | 54990..55721 | + | 732 | WP_273818325 | conjugal transfer complement resistance protein TraT | - |
PS038_RS23280 (PS038_23280) | 55974..58145 | + | 2172 | WP_156849463 | type IV conjugative transfer system coupling protein TraD | virb4 |
Host bacterium
ID | 4531 | GenBank | NZ_CP117611 |
Plasmid name | pEA26_2 | Incompatibility group | IncFIB |
Plasmid size | 107716 bp | Coordinate of oriT [Strand] | 26229..26580 [+] |
Host baterium | Escherichia albertii strain BIA_26 |
Cargo genes
Drug resistance gene | - |
Virulence gene | vat, espO1-1 |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |