Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104080
Name   oriT_pEA15_1 in_silico
Organism   Escherichia albertii strain BIA_15
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP117655 (108679..108807 [-], 129 nt)
oriT length   129 nt
IRs (inverted repeats)      106..111, 124..129  (TTTAAT..ATTAAA)
 96..104, 118..126  (AATAATGTA..TACATTATT)
 95..100, 112..117  (AAATAA..TTATTT)
 44..51, 54..61  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 129 nt

>oriT_pEA15_1
GGTTGGTGGTTCTCACCACCAAAAGCACCGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   1280 GenBank   WP_001254386
Name   WP_001254386_pEA15_1 insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5

ID   1281 GenBank   WP_000124981
Name   WP_000124981_pEA15_1 insolico UniProt ID   A0A630FTW9
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14542.59 Da        Isoelectric Point: 5.0278

>WP_000124981.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A630FTW9


T4CP


ID   2896 GenBank   WP_273811144
Name   traC_PS036_RS24235_pEA15_1 insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99354.11 Da        Isoelectric Point: 6.3032

>WP_273811144.1 type IV secretion system protein TraC [Escherichia albertii]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAA
ATQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLREKGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKKNKARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSRHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(290-447)

(468-772)

(39-277)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 86509..109379

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PS036_RS24135 (PS036_24135) 82281..82628 - 348 WP_000624622 IS66 family insertion sequence element accessory protein TnpB -
PS036_RS24140 (PS036_24140) 82628..83305 - 678 WP_001339397 IS66-like element accessory protein TnpA -
PS036_RS24145 (PS036_24145) 83359..84273 - 915 Protein_85 TraD N-terminal domain-containing protein -
PS036_RS24150 (PS036_24150) 84324..84758 - 435 Protein_86 hypothetical protein -
PS036_RS24155 (PS036_24155) 84790..85059 - 270 WP_059277992 hypothetical protein -
PS036_RS24160 (PS036_24160) 85259..85972 - 714 WP_000989337 conjugal transfer complement resistance protein TraT -
PS036_RS24165 (PS036_24165) 86003..86512 - 510 WP_059277993 conjugal transfer entry exclusion protein TraS -
PS036_RS24170 (PS036_24170) 86509..89334 - 2826 WP_273811141 conjugal transfer mating-pair stabilization protein TraG traG
PS036_RS24175 (PS036_24175) 89331..90704 - 1374 WP_273811233 conjugal transfer pilus assembly protein TraH traH
PS036_RS24180 (PS036_24180) 90704..91066 - 363 WP_002430925 P-type conjugative transfer protein TrbJ -
PS036_RS24185 (PS036_24185) 90996..91541 - 546 WP_000052614 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
PS036_RS24190 (PS036_24190) 91528..91812 - 285 WP_000624110 type-F conjugative transfer system pilin chaperone TraQ -
PS036_RS24195 (PS036_24195) 91931..92278 - 348 WP_001287677 conjugal transfer protein TrbA -
PS036_RS24200 (PS036_24200) 92294..93037 - 744 WP_001030376 type-F conjugative transfer system pilin assembly protein TraF traF
PS036_RS24205 (PS036_24205) 93030..93287 - 258 WP_000864325 conjugal transfer protein TrbE -
PS036_RS24210 (PS036_24210) 93314..95122 - 1809 WP_001567342 type-F conjugative transfer system mating-pair stabilization protein TraN traN
PS036_RS24215 (PS036_24215) 95119..95757 - 639 WP_059277995 type-F conjugative transfer system pilin assembly protein TrbC trbC
PS036_RS24220 (PS036_24220) 95766..96758 - 993 WP_000830839 conjugal transfer pilus assembly protein TraU traU
PS036_RS24225 (PS036_24225) 96755..97387 - 633 WP_001203720 type-F conjugative transfer system protein TraW traW
PS036_RS24230 (PS036_24230) 97384..97770 - 387 WP_000099690 type-F conjugative transfer system protein TrbI -
PS036_RS24235 (PS036_24235) 97767..100397 - 2631 WP_273811144 type IV secretion system protein TraC virb4
PS036_RS24240 (PS036_24240) 100524..100871 - 348 WP_000802783 hypothetical protein -
PS036_RS24245 (PS036_24245) 100899..101116 - 218 Protein_105 hypothetical protein -
PS036_RS24250 (PS036_24250) 101196..101672 - 477 WP_000549579 hypothetical protein -
PS036_RS24255 (PS036_24255) 101665..101886 - 222 WP_001278695 conjugal transfer protein TraR -
PS036_RS24260 (PS036_24260) 102021..102536 - 516 WP_000809874 type IV conjugative transfer system lipoprotein TraV traV
PS036_RS24265 (PS036_24265) 102533..102853 - 321 WP_273811150 conjugal transfer protein TrbD -
PS036_RS24270 (PS036_24270) 102840..103430 - 591 WP_000002784 conjugal transfer pilus-stabilizing protein TraP -
PS036_RS24275 (PS036_24275) 103420..104847 - 1428 WP_059278117 F-type conjugal transfer pilus assembly protein TraB traB
PS036_RS24280 (PS036_24280) 104847..105575 - 729 WP_001230798 type-F conjugative transfer system secretin TraK traK
PS036_RS24285 (PS036_24285) 105562..106128 - 567 WP_000399792 type IV conjugative transfer system protein TraE traE
PS036_RS24290 (PS036_24290) 106150..106461 - 312 WP_000012106 type IV conjugative transfer system protein TraL traL
PS036_RS24295 (PS036_24295) 106476..106835 - 360 WP_000340272 type IV conjugative transfer system pilin TraA -
PS036_RS24300 (PS036_24300) 106869..107096 - 228 WP_001254386 conjugal transfer relaxosome protein TraY -
PS036_RS24305 (PS036_24305) 107190..107876 - 687 WP_000332484 PAS domain-containing protein -
PS036_RS24310 (PS036_24310) 108067..108450 - 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
PS036_RS24315 (PS036_24315) 108789..109379 + 591 WP_337961716 transglycosylase SLT domain-containing protein -
PS036_RS24320 (PS036_24320) 109676..110497 - 822 WP_273811154 DUF932 domain-containing protein -
PS036_RS24325 (PS036_24325) 110617..110904 - 288 WP_000107535 hypothetical protein -
PS036_RS24330 (PS036_24330) 110929..111135 - 207 WP_000547968 hypothetical protein -
PS036_RS24335 (PS036_24335) 111205..111364 + 160 Protein_123 hypothetical protein -
PS036_RS24340 (PS036_24340) 111362..111592 - 231 WP_262933420 hypothetical protein -
PS036_RS24345 (PS036_24345) 111814..111939 - 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
PS036_RS24350 (PS036_24350) 111881..112030 - 150 Protein_126 plasmid maintenance protein Mok -
PS036_RS24355 (PS036_24355) 112052..112240 + 189 WP_001299721 hypothetical protein -
PS036_RS24360 (PS036_24360) 112209..112971 - 763 Protein_128 plasmid SOS inhibition protein A -
PS036_RS24365 (PS036_24365) 112968..113402 - 435 WP_000845953 conjugation system SOS inhibitor PsiB -


Host bacterium


ID   4519 GenBank   NZ_CP117655
Plasmid name   pEA15_1 Incompatibility group   IncFIB
Plasmid size   130064 bp Coordinate of oriT [Strand]   108679..108807 [-]
Host baterium   Escherichia albertii strain BIA_15

Cargo genes


Drug resistance gene   -
Virulence gene   vat
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -