Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 104070 |
| Name | oriT_pEA18_1  |
| Organism | Escherichia albertii strain BIA_18 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP117638 (79316..79666 [+], 351 nt) |
| oriT length | 351 nt |
| IRs (inverted repeats) | 192..198, 206..212 (TATAAAA..TTTTATA) 128..134, 148..154 (GCGGTGT..ACACCGC) 40..47, 50..57 (GCAAAAAC..GTTTTTGC) 4..11, 16..23 (TTGGTGGT..ACCACCAA) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 351 nt
>oriT_pEA18_1
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACACTACGCAAAAACAAGTTTTTGCTGATTTTTATTTATAAATAGAGAGTTATGAAAAATTAGTTTCTCTTACTCTCTTTGTGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACACCGCGCCGACACCGCTTTATAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGCGCTGCTAGCGGCGCGGTGTGTTTTTTATAGGATAACGCCAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA
AGGTTGGTGGTTCTCACCACCAAAAGCACCACACACTACGCAAAAACAAGTTTTTGCTGATTTTTATTTATAAATAGAGAGTTATGAAAAATTAGTTTCTCTTACTCTCTTTGTGATATTTAAAAAAGCGGTGTCGGCGCGGCTACAACACCGCGCCGACACCGCTTTATAGGGGTGGTACTGACTATTTTTATAAAAAACATTATTTTATATTAGGGGCGCTGCTAGCGGCGCGGTGTGTTTTTTATAGGATAACGCCAGGGGCGCTGCTAGCGGTGCGTCCCTGTTTGCATTATGAATTTTAGTGTTTCGAAATTAACTTTATTTTATGTTCAAAAAAGGTAATCTCTA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2888 | GenBank | WP_273784057 |
| Name | traD_PS040_RS24525_pEA18_1 |
UniProt ID | _ |
| Length | 723 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 723 a.a. Molecular weight: 82183.73 Da Isoelectric Point: 5.0524
>WP_273784057.1 type IV conjugative transfer system coupling protein TraD [Escherichia albertii]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQ
RREEVNINVHRERGEDVEPGDDF
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILVGLVLWVKISWQTFVNGCIYWWCTTLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLATVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTENPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGESFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQTRPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPDVPEVVSGEDVTQAEQPQQPQQPQQ
PVSPAINDKKSDSGVNVPAGGIEQELKMKPEEEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQQMQ
RREEVNINVHRERGEDVEPGDDF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 78745..86505
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS24335 (PS040_24335) | 74124..74276 | + | 153 | Protein_76 | DUF5431 family protein | - |
| PS040_RS24340 (PS040_24340) | 74221..74343 | + | 123 | WP_223170659 | type I toxin-antitoxin system Hok family toxin | - |
| PS040_RS24345 (PS040_24345) | 74742..76096 | - | 1355 | Protein_78 | group II intron reverse transcriptase/maturase | - |
| PS040_RS24350 (PS040_24350) | 76825..76998 | - | 174 | Protein_79 | hypothetical protein | - |
| PS040_RS24355 (PS040_24355) | 77068..77226 | + | 159 | WP_273784018 | hypothetical protein | - |
| PS040_RS24360 (PS040_24360) | 77223..77510 | + | 288 | Protein_81 | hypothetical protein | - |
| PS040_RS24365 (PS040_24365) | 77629..78449 | + | 821 | Protein_82 | DUF932 domain-containing protein | - |
| PS040_RS24370 (PS040_24370) | 78745..79347 | - | 603 | WP_273784019 | transglycosylase SLT domain-containing protein | virB1 |
| PS040_RS24375 (PS040_24375) | 79667..80050 | + | 384 | WP_046788507 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PS040_RS24380 (PS040_24380) | 80237..80926 | + | 690 | WP_273784024 | conjugal transfer transcriptional regulator TraJ | - |
| PS040_RS24385 (PS040_24385) | 81025..81420 | + | 396 | WP_001309237 | conjugal transfer relaxosome DNA-bindin protein TraY | - |
| PS040_RS24390 (PS040_24390) | 81453..81812 | + | 360 | WP_000994781 | type IV conjugative transfer system pilin TraA | - |
| PS040_RS24395 (PS040_24395) | 81827..82138 | + | 312 | WP_071940841 | type IV conjugative transfer system protein TraL | traL |
| PS040_RS24400 (PS040_24400) | 82160..82726 | + | 567 | WP_001378930 | type IV conjugative transfer system protein TraE | traE |
| PS040_RS24405 (PS040_24405) | 82713..83441 | + | 729 | WP_273784029 | type-F conjugative transfer system secretin TraK | traK |
| PS040_RS24410 (PS040_24410) | 83441..84892 | + | 1452 | WP_273784031 | F-type conjugal transfer pilus assembly protein TraB | traB |
| PS040_RS24415 (PS040_24415) | 84882..85442 | + | 561 | WP_273784033 | conjugal transfer pilus-stabilizing protein TraP | - |
| PS040_RS24420 (PS040_24420) | 85429..85749 | + | 321 | WP_001057293 | conjugal transfer protein TrbD | virb4 |
| PS040_RS24425 (PS040_24425) | 85742..85993 | + | 252 | WP_001038344 | conjugal transfer protein TrbG | - |
| PS040_RS24430 (PS040_24430) | 85990..86505 | + | 516 | WP_273784037 | type IV conjugative transfer system lipoprotein TraV | traV |
| PS040_RS24435 (PS040_24435) | 86640..86861 | + | 222 | WP_001278700 | conjugal transfer protein TraR | - |
| PS040_RS24440 (PS040_24440) | 86854..87327 | + | 474 | WP_273784041 | hypothetical protein | - |
| PS040_RS24445 (PS040_24445) | 87407..87622 | + | 216 | WP_024217748 | hypothetical protein | - |
| PS040_RS24450 (PS040_24450) | 87650..88012 | + | 363 | WP_273784075 | hypothetical protein | - |
| PS040_RS24455 (PS040_24455) | 88138..90189 | + | 2052 | Protein_100 | type IV secretion system protein TraC | - |
Region 2: 102905..118113
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PS040_RS24525 (PS040_24525) | 102905..105076 | - | 2172 | WP_273784057 | type IV conjugative transfer system coupling protein TraD | virb4 |
| PS040_RS24530 (PS040_24530) | 105328..106059 | - | 732 | WP_273784059 | conjugal transfer complement resistance protein TraT | - |
| PS040_RS24535 (PS040_24535) | 106073..106592 | - | 520 | Protein_116 | conjugal transfer entry exclusion protein TraS | - |
| PS040_RS24540 (PS040_24540) | 106589..109414 | - | 2826 | WP_089606830 | conjugal transfer mating-pair stabilization protein TraG | traG |
| PS040_RS24545 (PS040_24545) | 109411..110784 | - | 1374 | WP_273784063 | conjugal transfer pilus assembly protein TraH | traH |
| PS040_RS24550 (PS040_24550) | 110771..111163 | - | 393 | WP_000662237 | F-type conjugal transfer protein TrbF | - |
| PS040_RS24555 (PS040_24555) | 111150..111491 | - | 342 | WP_071528036 | P-type conjugative transfer protein TrbJ | - |
| PS040_RS24560 (PS040_24560) | 111421..111966 | - | 546 | WP_054191927 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| PS040_RS24565 (PS040_24565) | 111953..112189 | - | 237 | WP_273784076 | type-F conjugative transfer system pilin chaperone TraQ | - |
| PS040_RS24570 (PS040_24570) | 112350..113093 | - | 744 | WP_001030371 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| PS040_RS24575 (PS040_24575) | 113086..113343 | - | 258 | WP_000864325 | conjugal transfer protein TrbE | - |
| PS040_RS24580 (PS040_24580) | 113370..115232 | - | 1863 | WP_273784064 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| PS040_RS24585 (PS040_24585) | 115468..115848 | - | 381 | WP_187181029 | hypothetical protein | - |
| PS040_RS24590 (PS040_24590) | 115845..116483 | - | 639 | WP_273784077 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| PS040_RS24595 (PS040_24595) | 116492..117484 | - | 993 | WP_000830839 | conjugal transfer pilus assembly protein TraU | traU |
| PS040_RS24600 (PS040_24600) | 117481..118113 | - | 633 | WP_273784065 | type-F conjugative transfer system protein TraW | traW |
| PS040_RS24605 (PS040_24605) | 118110..118496 | - | 387 | WP_000214096 | type-F conjugative transfer system protein TrbI | - |
| PS040_RS24610 (PS040_24610) | 118493..119080 | - | 588 | Protein_131 | hypothetical protein | - |
| PS040_RS24615 (PS040_24615) | 119165..119590 | + | 426 | WP_000422741 | transposase | - |
| PS040_RS24620 (PS040_24620) | 119587..119937 | + | 351 | WP_000624718 | IS66 family insertion sequence element accessory protein TnpB | - |
| PS040_RS24625 (PS040_24625) | 119968..121560 | + | 1593 | WP_048237919 | IS66 family transposase | - |
| PS040_RS24630 (PS040_24630) | 121583..122381 | - | 799 | Protein_135 | IS110 family transposase | - |
Host bacterium
| ID | 4509 | GenBank | NZ_CP117638 |
| Plasmid name | pEA18_1 | Incompatibility group | IncFIB |
| Plasmid size | 144030 bp | Coordinate of oriT [Strand] | 79316..79666 [+] |
| Host baterium | Escherichia albertii strain BIA_18 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | iucA, iucB, iucC, iucD, iutA, gspH, gspG, vat |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |