Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   104061
Name   oriT_pKP700 in_silico
Organism   Klebsiella pneumoniae strain KP700
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_OL804393 (22689..22787 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_pKP700
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3006 GenBank   WP_000130000
Name   Replic_Relax_MCP58_RS00065_pKP700 insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   4500 GenBank   NZ_OL804393
Plasmid name   pKP700 Incompatibility group   IncR
Plasmid size   83452 bp Coordinate of oriT [Strand]   22689..22787 [+]
Host baterium   Klebsiella pneumoniae strain KP700

Cargo genes

Drug resistance gene   aph(3')-Ia, mph(A), sul1, qacE, ARR-3, catB3, blaOXA-1, aac(6')-Ib-cr, mcr-8, rmtB, blaTEM-1B, aac(3)-IId
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -