Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   104035
Name   oriT_pAK76 in_silico
Organism   Sinorhizobium meliloti strain AK76
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP066360 (50512..50566 [-], 55 nt)
oriT length   55 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 55 nt

>oriT_pAK76
GCAGAAAACGGGCGTAGCACATTTTTCCGTATCCTGCCACTCTCAATAGAAAGGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2856 GenBank   WP_198868924
Name   t4cp2_JFX10_RS25000_pAK76 insolico UniProt ID   _
Length   694 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 694 a.a.        Molecular weight: 77279.15 Da        Isoelectric Point: 9.7614

>WP_198868924.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQACYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQLWHYKTSPALQKVALGS
MVPALLVAGFVGYIGLKPTSSPLGDAAFQDIASLRRGKWFRKQGHIFGRIGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHQGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGAISYITESHFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALMDIQKAMRPFKNERIIAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMNKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLAPKPVPATTP
EYAKGGDPSVEMSSAQAKEEKPLTAAAAEAAPVKAEPAADEKAAAPVKRTVNKKALRPKPNATGGGEASA
SLNAMEARIKAIEEGLKPKAAQLKEVVETKAEKLGDKSPTRRRNIMDIFSATVPDPIEVGVPAE

  Protein domains


Predicted by InterproScan.

(104-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 60606..70516

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JFX10_RS24990 (JFX10_24980) 56499..57152 + 654 WP_198868922 polymorphic toxin type 44 domain-containing protein -
JFX10_RS24995 (JFX10_24985) 57531..58361 + 831 WP_198868923 hypothetical protein -
JFX10_RS25000 (JFX10_24990) 58525..60609 - 2085 WP_198868924 type IV secretory system conjugative DNA transfer family protein -
JFX10_RS25005 (JFX10_24995) 60606..61634 - 1029 WP_198868925 P-type DNA transfer ATPase VirB11 virB11
JFX10_RS25010 (JFX10_25000) 61615..62826 - 1212 WP_198868926 type IV secretion system protein VirB10 virB10
JFX10_RS25015 (JFX10_25005) 62826..63635 - 810 WP_198868927 TrbG/VirB9 family P-type conjugative transfer protein virB9
JFX10_RS25020 (JFX10_25010) 63632..64327 - 696 WP_198868928 type IV secretion system protein virB8
JFX10_RS25025 (JFX10_25015) 64354..65382 - 1029 WP_198868929 type IV secretion system protein virB6
JFX10_RS25030 (JFX10_25020) 65398..65625 - 228 WP_142586835 hypothetical protein -
JFX10_RS25035 (JFX10_25025) 65615..66316 - 702 WP_127620009 type IV secretion system protein -
JFX10_RS25040 (JFX10_25030) 66328..67416 - 1089 WP_198868946 lytic transglycosylase domain-containing protein -
JFX10_RS25045 (JFX10_25035) 67413..69872 - 2460 WP_198868930 VirB4 family type IV secretion/conjugal transfer ATPase virb4
JFX10_RS25050 (JFX10_25040) 69875..70174 - 300 WP_142586832 VirB3 family type IV secretion system protein virB3
JFX10_RS25055 (JFX10_25045) 70178..70516 - 339 WP_142586831 TrbC/VirB2 family protein virB2
JFX10_RS25060 (JFX10_25050) 70528..71436 - 909 WP_198868947 lytic transglycosylase domain-containing protein -
JFX10_RS25065 (JFX10_25055) 71659..72267 + 609 WP_198868931 hypothetical protein -
JFX10_RS25070 (JFX10_25060) 72264..72800 + 537 WP_198868932 thermonuclease family protein -
JFX10_RS25075 (JFX10_25065) 72797..73498 + 702 WP_198868933 thermonuclease family protein -
JFX10_RS33570 73613..73825 + 213 WP_234943692 hypothetical protein -
JFX10_RS25085 (JFX10_25075) 73905..74498 + 594 Protein_71 hypothetical protein -
JFX10_RS25090 (JFX10_25080) 74521..74937 + 417 WP_198868934 hypothetical protein -


Host bacterium


ID   4474 GenBank   NZ_CP066360
Plasmid name   pAK76 Incompatibility group   -
Plasmid size   172809 bp Coordinate of oriT [Strand]   50512..50566 [-]
Host baterium   Sinorhizobium meliloti strain AK76

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA7