Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103861 |
| Name | oriT_pRM4283-2 |
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain RM4283 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP028155 (10654..10706 [+], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pRM4283-2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2709 | GenBank | WP_000338974 |
| Name | t4cp2_SEEERM4283_RS00330_pRM4283-2 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 29774..53020
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SEEERM4283_RS00190 (SEEERM4283_00190) | 25527..25979 | + | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
| SEEERM4283_RS00195 (SEEERM4283_00195) | 25972..26187 | + | 216 | WP_001127357 | DUF1187 family protein | - |
| SEEERM4283_RS24750 | 26180..26356 | + | 177 | WP_000753049 | hypothetical protein | - |
| SEEERM4283_RS00200 (SEEERM4283_00200) | 26383..27336 | + | 954 | WP_072089442 | SPFH domain-containing protein | - |
| SEEERM4283_RS00210 (SEEERM4283_00210) | 27710..28153 | + | 444 | WP_000964330 | NfeD family protein | - |
| SEEERM4283_RS24755 | 28157..28327 | + | 171 | WP_000550720 | hypothetical protein | - |
| SEEERM4283_RS00215 (SEEERM4283_00215) | 28338..28799 | + | 462 | WP_001243166 | hypothetical protein | - |
| SEEERM4283_RS00225 (SEEERM4283_00225) | 28947..29198 | + | 252 | WP_015387362 | hypothetical protein | - |
| SEEERM4283_RS00230 (SEEERM4283_00230) | 29214..29516 | + | 303 | WP_001360345 | hypothetical protein | - |
| SEEERM4283_RS00235 (SEEERM4283_00235) | 29513..29770 | + | 258 | WP_000739144 | hypothetical protein | - |
| SEEERM4283_RS00240 (SEEERM4283_00240) | 29774..30769 | + | 996 | WP_001028543 | type IV secretion system protein | virB6 |
| SEEERM4283_RS00245 (SEEERM4283_00245) | 30775..31416 | + | 642 | WP_001425343 | type IV secretion system protein | - |
| SEEERM4283_RS00250 (SEEERM4283_00250) | 31418..31672 | + | 255 | WP_001043555 | EexN family lipoprotein | - |
| SEEERM4283_RS00255 (SEEERM4283_00255) | 31685..31972 | + | 288 | WP_001032611 | EexN family lipoprotein | - |
| SEEERM4283_RS00260 (SEEERM4283_00260) | 32045..32680 | + | 636 | WP_000835773 | hypothetical protein | - |
| SEEERM4283_RS00265 (SEEERM4283_00265) | 32852..33139 | + | 288 | WP_001326593 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| SEEERM4283_RS00270 (SEEERM4283_00270) | 33142..34377 | + | 1236 | WP_110140978 | toxin co-regulated pilus biosynthesis Q family protein | - |
| SEEERM4283_RS00275 (SEEERM4283_00275) | 34383..34820 | + | 438 | WP_000539666 | type IV pilus biogenesis protein PilM | - |
| SEEERM4283_RS00280 (SEEERM4283_00280) | 35160..35558 | + | 399 | WP_001153669 | hypothetical protein | - |
| SEEERM4283_RS00285 (SEEERM4283_00285) | 35579..36163 | + | 585 | WP_001177114 | lytic transglycosylase domain-containing protein | virB1 |
| SEEERM4283_RS24760 | 36163..36453 | + | 291 | WP_000865478 | TrbC/VirB2 family protein | virB2 |
| SEEERM4283_RS00295 (SEEERM4283_00295) | 36524..36844 | + | 321 | WP_000362081 | VirB3 family type IV secretion system protein | virB3 |
| SEEERM4283_RS00300 (SEEERM4283_00300) | 36850..39207 | + | 2358 | WP_000548954 | VirB4 family type IV secretion system protein | virb4 |
| SEEERM4283_RS00310 (SEEERM4283_00310) | 39373..40107 | + | 735 | WP_000432283 | type IV secretion system protein | virB8 |
| SEEERM4283_RS00315 (SEEERM4283_00315) | 40173..40874 | + | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| SEEERM4283_RS00320 (SEEERM4283_00320) | 40864..42003 | + | 1140 | WP_000790641 | TrbI/VirB10 family protein | virB10 |
| SEEERM4283_RS00325 (SEEERM4283_00325) | 42126..43181 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| SEEERM4283_RS00330 (SEEERM4283_00330) | 43197..45155 | + | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| SEEERM4283_RS00335 (SEEERM4283_00335) | 45202..45732 | + | 531 | WP_001220542 | sigma 54-interacting transcriptional regulator | virb4 |
| SEEERM4283_RS00340 (SEEERM4283_00340) | 45725..47368 | + | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
| SEEERM4283_RS00345 (SEEERM4283_00345) | 47407..48729 | + | 1323 | WP_000454142 | type 4b pilus protein PilO2 | - |
| SEEERM4283_RS00350 (SEEERM4283_00350) | 48713..49207 | + | 495 | WP_000912552 | type IV pilus biogenesis protein PilP | - |
| SEEERM4283_RS00355 (SEEERM4283_00355) | 49232..50770 | + | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| SEEERM4283_RS00360 (SEEERM4283_00360) | 50761..51870 | + | 1110 | WP_000974901 | type II secretion system F family protein | - |
| SEEERM4283_RS00365 (SEEERM4283_00365) | 51915..52472 | + | 558 | WP_000095048 | type 4 pilus major pilin | - |
| SEEERM4283_RS00370 (SEEERM4283_00370) | 52538..53020 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| SEEERM4283_RS00375 (SEEERM4283_00375) | 53024..53659 | + | 636 | WP_000934978 | A24 family peptidase | - |
| SEEERM4283_RS00380 (SEEERM4283_00380) | 53672..54958 | + | 1287 | WP_015059540 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| SEEERM4283_RS25245 (SEEERM4283_00390) | 55272..55493 | + | 222 | Protein_70 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| SEEERM4283_RS00410 (SEEERM4283_00410) | 56407..57531 | + | 1125 | WP_000486715 | site-specific integrase | - |
Host bacterium
| ID | 4301 | GenBank | NZ_CP028155 |
| Plasmid name | pRM4283-2 | Incompatibility group | IncI2 |
| Plasmid size | 60014 bp | Coordinate of oriT [Strand] | 10654..10706 [+] |
| Host baterium | Salmonella enterica subsp. enterica serovar Enteritidis strain RM4283 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |