Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103861
Name   oriT_pRM4283-2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Enteritidis strain RM4283
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP028155 (10654..10706 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pRM4283-2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2709 GenBank   WP_000338974
Name   t4cp2_SEEERM4283_RS00330_pRM4283-2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 29774..53020

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SEEERM4283_RS00190 (SEEERM4283_00190) 25527..25979 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
SEEERM4283_RS00195 (SEEERM4283_00195) 25972..26187 + 216 WP_001127357 DUF1187 family protein -
SEEERM4283_RS24750 26180..26356 + 177 WP_000753049 hypothetical protein -
SEEERM4283_RS00200 (SEEERM4283_00200) 26383..27336 + 954 WP_072089442 SPFH domain-containing protein -
SEEERM4283_RS00210 (SEEERM4283_00210) 27710..28153 + 444 WP_000964330 NfeD family protein -
SEEERM4283_RS24755 28157..28327 + 171 WP_000550720 hypothetical protein -
SEEERM4283_RS00215 (SEEERM4283_00215) 28338..28799 + 462 WP_001243166 hypothetical protein -
SEEERM4283_RS00225 (SEEERM4283_00225) 28947..29198 + 252 WP_015387362 hypothetical protein -
SEEERM4283_RS00230 (SEEERM4283_00230) 29214..29516 + 303 WP_001360345 hypothetical protein -
SEEERM4283_RS00235 (SEEERM4283_00235) 29513..29770 + 258 WP_000739144 hypothetical protein -
SEEERM4283_RS00240 (SEEERM4283_00240) 29774..30769 + 996 WP_001028543 type IV secretion system protein virB6
SEEERM4283_RS00245 (SEEERM4283_00245) 30775..31416 + 642 WP_001425343 type IV secretion system protein -
SEEERM4283_RS00250 (SEEERM4283_00250) 31418..31672 + 255 WP_001043555 EexN family lipoprotein -
SEEERM4283_RS00255 (SEEERM4283_00255) 31685..31972 + 288 WP_001032611 EexN family lipoprotein -
SEEERM4283_RS00260 (SEEERM4283_00260) 32045..32680 + 636 WP_000835773 hypothetical protein -
SEEERM4283_RS00265 (SEEERM4283_00265) 32852..33139 + 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
SEEERM4283_RS00270 (SEEERM4283_00270) 33142..34377 + 1236 WP_110140978 toxin co-regulated pilus biosynthesis Q family protein -
SEEERM4283_RS00275 (SEEERM4283_00275) 34383..34820 + 438 WP_000539666 type IV pilus biogenesis protein PilM -
SEEERM4283_RS00280 (SEEERM4283_00280) 35160..35558 + 399 WP_001153669 hypothetical protein -
SEEERM4283_RS00285 (SEEERM4283_00285) 35579..36163 + 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
SEEERM4283_RS24760 36163..36453 + 291 WP_000865478 TrbC/VirB2 family protein virB2
SEEERM4283_RS00295 (SEEERM4283_00295) 36524..36844 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
SEEERM4283_RS00300 (SEEERM4283_00300) 36850..39207 + 2358 WP_000548954 VirB4 family type IV secretion system protein virb4
SEEERM4283_RS00310 (SEEERM4283_00310) 39373..40107 + 735 WP_000432283 type IV secretion system protein virB8
SEEERM4283_RS00315 (SEEERM4283_00315) 40173..40874 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
SEEERM4283_RS00320 (SEEERM4283_00320) 40864..42003 + 1140 WP_000790641 TrbI/VirB10 family protein virB10
SEEERM4283_RS00325 (SEEERM4283_00325) 42126..43181 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
SEEERM4283_RS00330 (SEEERM4283_00330) 43197..45155 + 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
SEEERM4283_RS00335 (SEEERM4283_00335) 45202..45732 + 531 WP_001220542 sigma 54-interacting transcriptional regulator virb4
SEEERM4283_RS00340 (SEEERM4283_00340) 45725..47368 + 1644 WP_001035590 PilN family type IVB pilus formation outer membrane protein -
SEEERM4283_RS00345 (SEEERM4283_00345) 47407..48729 + 1323 WP_000454142 type 4b pilus protein PilO2 -
SEEERM4283_RS00350 (SEEERM4283_00350) 48713..49207 + 495 WP_000912552 type IV pilus biogenesis protein PilP -
SEEERM4283_RS00355 (SEEERM4283_00355) 49232..50770 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
SEEERM4283_RS00360 (SEEERM4283_00360) 50761..51870 + 1110 WP_000974901 type II secretion system F family protein -
SEEERM4283_RS00365 (SEEERM4283_00365) 51915..52472 + 558 WP_000095048 type 4 pilus major pilin -
SEEERM4283_RS00370 (SEEERM4283_00370) 52538..53020 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
SEEERM4283_RS00375 (SEEERM4283_00375) 53024..53659 + 636 WP_000934978 A24 family peptidase -
SEEERM4283_RS00380 (SEEERM4283_00380) 53672..54958 + 1287 WP_015059540 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SEEERM4283_RS25245 (SEEERM4283_00390) 55272..55493 + 222 Protein_70 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
SEEERM4283_RS00410 (SEEERM4283_00410) 56407..57531 + 1125 WP_000486715 site-specific integrase -


Host bacterium


ID   4301 GenBank   NZ_CP028155
Plasmid name   pRM4283-2 Incompatibility group   IncI2
Plasmid size   60014 bp Coordinate of oriT [Strand]   10654..10706 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Enteritidis strain RM4283

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -