Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103860
Name   oriT_T073|accessoryA in_silico
Organism   Sinorhizobium meliloti strain T073
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP021807 (121624..121680 [+], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_T073|accessoryA
GCAGGAAAATGGCGTAGCACGTTTTTCCGTATCCTGCCTCTCCCAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2708 GenBank   WP_088196651
Name   t4cp2_CDO28_RS34315_T073|accessoryA insolico UniProt ID   _
Length   706 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 706 a.a.        Molecular weight: 79028.80 Da        Isoelectric Point: 9.5383

>WP_088196651.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYRDGRILETTITSNPFVPIQQFWHYKTSTALQKVALGS
MVPALLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRVGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTESENSVWQATAQQVLAGAISYITESPFYKDRRNLAEVNSFFNSGVDLQTLMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLTPKPVPATTP
EYAKGGDPSVEIPASALTLEDARAIAEPAEPAPVKQQSPAEEKAVEPTKRSVNRKALRPKPKGTTAKAGG
ATSSVSIDDMEARIRAIEEGLKPKATQLKEVVETKVQKLRDNSPTTRRNFMDIFNATVPDPAEVGVAGNE
DEGFDN

  Protein domains


Predicted by InterproScan.

(103-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 61173..71084

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDO28_RS34225 (CDO28_34225) 56748..57164 - 417 WP_088196638 hypothetical protein -
CDO28_RS34230 (CDO28_34230) 57189..57782 - 594 Protein_48 hypothetical protein -
CDO28_RS34235 (CDO28_34235) 57784..58131 - 348 WP_234827325 hypothetical protein -
CDO28_RS34240 (CDO28_34240) 58189..58890 - 702 WP_088196640 thermonuclease family protein -
CDO28_RS34245 (CDO28_34245) 58887..59423 - 537 WP_088196641 succinoglycan biosynthesis protein exoi -
CDO28_RS34250 (CDO28_34250) 59420..60028 - 609 WP_088196642 hypothetical protein -
CDO28_RS34255 (CDO28_34255) 60188..61162 + 975 WP_234827326 lytic transglycosylase domain-containing protein -
CDO28_RS34260 (CDO28_34260) 61173..61511 + 339 WP_017265136 TrbC/VirB2 family protein virB2
CDO28_RS34265 (CDO28_34265) 61515..61814 + 300 WP_020479309 VirB3 family type IV secretion system protein virB3
CDO28_RS34270 (CDO28_34270) 61817..64276 + 2460 WP_088196643 VirB4 family type IV secretion/conjugal transfer ATPase virb4
CDO28_RS34275 (CDO28_34275) 64273..65361 + 1089 WP_088196644 lytic transglycosylase domain-containing protein -
CDO28_RS34280 (CDO28_34280) 65373..66074 + 702 WP_088196645 type IV secretion system protein -
CDO28_RS34285 (CDO28_34285) 66064..66291 + 228 WP_088196646 hypothetical protein -
CDO28_RS34290 (CDO28_34290) 66307..67335 + 1029 WP_088196647 type IV secretion system protein virB6
CDO28_RS34295 (CDO28_34295) 67362..68057 + 696 WP_088196648 type IV secretion system protein virB8
CDO28_RS34300 (CDO28_34300) 68054..68864 + 811 Protein_62 TrbG/VirB9 family P-type conjugative transfer protein -
CDO28_RS34305 (CDO28_34305) 68864..70075 + 1212 WP_088196649 type IV secretion system protein VirB10 virB10
CDO28_RS34310 (CDO28_34310) 70056..71084 + 1029 WP_088196650 P-type DNA transfer ATPase VirB11 virB11
CDO28_RS34315 (CDO28_34315) 71081..73201 + 2121 WP_088196651 type IV secretory system conjugative DNA transfer family protein -
CDO28_RS36585 73283..73708 - 426 WP_234827327 HlyD family efflux transporter periplasmic adaptor subunit -
CDO28_RS36590 73906..74169 - 264 WP_234827328 hypothetical protein -
CDO28_RS34325 (CDO28_34325) 74339..74572 - 234 WP_088196652 hypothetical protein -
CDO28_RS36595 74569..74739 - 171 WP_234827333 hypothetical protein -
CDO28_RS36600 74679..75257 - 579 WP_234827329 ATP-binding cassette domain-containing protein -
CDO28_RS36605 75388..75618 - 231 WP_234827330 hypothetical protein -


Host bacterium


ID   4300 GenBank   NZ_CP021807
Plasmid name   T073|accessoryA Incompatibility group   -
Plasmid size   158363 bp Coordinate of oriT [Strand]   121624..121680 [+]
Host baterium   Sinorhizobium meliloti strain T073

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -