Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103857
Name   oriT_USDA1021|accessoryA in_silico
Organism   Sinorhizobium meliloti strain USDA1021
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP021803 (102455..102511 [+], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_USDA1021|accessoryA
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2705 GenBank   WP_088204060
Name   t4cp2_CDO29_RS34920_USDA1021|accessoryA insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77864.76 Da        Isoelectric Point: 9.6664

>WP_088204060.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium meliloti]
MTKQLQAFYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQFWHYKTSPALQKVALGS
LVPAMLVAGLVAYIGLKPTSSPLGDAAFQDMASLRRGKWFRKQGHIFGRVGRNILRTRDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRENGSQVFLFAPGSEKTSSYNPLDFIRPERGNRT
TDIQNIASILVPENTASENSVWQATAQQVLAGAISYITESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNERIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDILTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPRVPEVDYLSPKPVPATTP
EYAKGGEPSVEIPSPAIEKEEKPVAAAAIQSAAVKEEPAADDMPSTTAKRTVNRKALRPSAKATAANTGG
AEASPSLDAMEARIRAIEEGLKPKAAQLREVVEMKAEKLGDKSPTKRRNIMDIFSATVPDPVEVGVAAE

  Protein domains


Predicted by InterproScan.

(103-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 79920..89843

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CDO29_RS34825 (CDO29_34810) 75088..75423 + 336 Protein_66 hypothetical protein -
CDO29_RS34830 (CDO29_34815) 75501..75916 - 416 Protein_67 hypothetical protein -
CDO29_RS34835 (CDO29_34820) 75938..76531 - 594 WP_088204051 hypothetical protein -
CDO29_RS34845 (CDO29_34830) 76938..77636 - 699 WP_088204052 thermonuclease family protein -
CDO29_RS34850 (CDO29_34835) 77633..78169 - 537 WP_088204053 succinoglycan biosynthesis protein exoi -
CDO29_RS34855 (CDO29_34840) 78166..78774 - 609 WP_088204054 hypothetical protein -
CDO29_RS34860 (CDO29_34845) 78997..79908 + 912 WP_153497611 lytic transglycosylase domain-containing protein -
CDO29_RS34865 (CDO29_34850) 79920..80258 + 339 WP_013845316 TrbC/VirB2 family protein virB2
CDO29_RS34870 (CDO29_34855) 80262..80561 + 300 WP_088204055 VirB3 family type IV secretion system protein virB3
CDO29_RS34875 (CDO29_34860) 80564..83023 + 2460 WP_088204056 VirB4 family type IV secretion/conjugal transfer ATPase virb4
CDO29_RS34880 (CDO29_34865) 83020..84108 + 1089 WP_088204057 lytic transglycosylase domain-containing protein -
CDO29_RS34885 (CDO29_34870) 84120..84821 + 702 WP_088204058 type IV secretion system protein -
CDO29_RS34890 (CDO29_34875) 84811..85038 + 228 WP_014531073 hypothetical protein -
CDO29_RS34895 (CDO29_34880) 85054..86082 + 1029 WP_014531072 type IV secretion system protein virB6
CDO29_RS34900 (CDO29_34885) 86122..86817 + 696 WP_017266187 type IV secretion system protein virB8
CDO29_RS34905 (CDO29_34890) 86814..87623 + 810 WP_017266188 TrbG/VirB9 family P-type conjugative transfer protein virB9
CDO29_RS34910 (CDO29_34895) 87623..88834 + 1212 WP_088204059 type IV secretion system protein VirB10 virB10
CDO29_RS34915 (CDO29_34900) 88815..89843 + 1029 WP_014531068 P-type DNA transfer ATPase VirB11 virB11
CDO29_RS34920 (CDO29_34905) 89840..91939 + 2100 WP_088204060 type IV secretory system conjugative DNA transfer family protein -
CDO29_RS34925 (CDO29_34910) 92727..94571 + 1845 WP_088204061 DUF3604 domain-containing protein -


Host bacterium


ID   4297 GenBank   NZ_CP021803
Plasmid name   USDA1021|accessoryA Incompatibility group   -
Plasmid size   297816 bp Coordinate of oriT [Strand]   102455..102511 [+]
Host baterium   Sinorhizobium meliloti strain USDA1021

Cargo genes


Drug resistance gene   -
Virulence gene   htpB
Metal resistance gene   -
Degradation gene   LinG, dxnH
Symbiosis gene   -
Anti-CRISPR   -