Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103824
Name   oriT_pR85_2-2 in_silico
Organism   Klebsiella pneumoniae strain Nord9_R85
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP091585 (21704..21752 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pR85_2-2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   1185 GenBank   WP_020805752
Name   WP_020805752_pR85_2-2 insolico UniProt ID   A0A377TIM3
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14772.81 Da        Isoelectric Point: 4.5715

>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE

  Protein domains


Predicted by InterproScan.

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A377TIM3


T4CP


ID   2662 GenBank   WP_032454979
Name   traD_L5468_RS29330_pR85_2-2 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 86062.11 Da        Isoelectric Point: 5.0175

>WP_032454979.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKRPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDEVEIGGNF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 2949..22310

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L5468_RS28735 (L5468_28740) 1..1105 - 1105 Protein_0 conjugal transfer protein TraG N-terminal domain-containing protein -
L5468_RS28740 (L5468_28745) 1105..2483 - 1379 Protein_1 conjugal transfer pilus assembly protein TraH -
L5468_RS28745 (L5468_28750) 2461..2904 - 444 Protein_2 F-type conjugal transfer protein TrbF -
L5468_RS28750 (L5468_28755) 2949..3506 - 558 WP_004152678 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
L5468_RS28755 (L5468_28760) 3478..3717 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
L5468_RS28760 (L5468_28765) 3728..4480 - 753 WP_009309874 type-F conjugative transfer system pilin assembly protein TraF traF
L5468_RS28765 (L5468_28770) 4501..4827 - 327 WP_004194451 hypothetical protein -
L5468_RS28770 (L5468_28775) 4840..5088 - 249 WP_004152675 hypothetical protein -
L5468_RS28775 (L5468_28780) 5066..5320 - 255 WP_004195500 conjugal transfer protein TrbE -
L5468_RS28780 (L5468_28785) 5352..7307 - 1956 WP_009309873 type-F conjugative transfer system mating-pair stabilization protein TraN traN
L5468_RS28785 (L5468_28790) 7366..8004 - 639 WP_004193871 type-F conjugative transfer system pilin assembly protein TrbC trbC
L5468_RS28790 (L5468_28795) 8017..9006 - 990 WP_009309872 conjugal transfer pilus assembly protein TraU traU
L5468_RS28795 (L5468_28800) 9003..9392 - 390 WP_004194992 hypothetical protein -
L5468_RS28800 (L5468_28805) 9434..10060 - 627 WP_004152507 type-F conjugative transfer system protein TraW traW
L5468_RS28805 (L5468_28810) 10060..10449 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
L5468_RS28810 (L5468_28815) 10446..13088 - 2643 WP_032454974 type IV secretion system protein TraC virb4
L5468_RS28815 (L5468_28820) 13160..13558 - 399 WP_074184101 hypothetical protein -
L5468_RS28820 (L5468_28825) 13936..14340 - 405 WP_004197817 hypothetical protein -
L5468_RS28825 (L5468_28830) 14407..14718 - 312 WP_004195240 hypothetical protein -
L5468_RS28830 (L5468_28835) 14719..14937 - 219 WP_004195235 hypothetical protein -
L5468_RS28835 (L5468_28840) 15043..15453 - 411 WP_004152499 hypothetical protein -
L5468_RS28840 (L5468_28845) 15585..16169 - 585 WP_032441881 type IV conjugative transfer system lipoprotein TraV traV
L5468_RS28845 (L5468_28850) 16283..17706 - 1424 Protein_22 F-type conjugal transfer pilus assembly protein TraB -
L5468_RS28850 (L5468_28855) 17706..18446 - 741 WP_013214019 type-F conjugative transfer system secretin TraK traK
L5468_RS28855 (L5468_28860) 18433..18999 - 567 WP_004144423 type IV conjugative transfer system protein TraE traE
L5468_RS28860 (L5468_28865) 19019..19324 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
L5468_RS28865 (L5468_28870) 19338..19706 - 369 WP_020316649 type IV conjugative transfer system pilin TraA -
L5468_RS29685 19775..19975 - 201 WP_050442686 TraY domain-containing protein -
L5468_RS28870 (L5468_28875) 20059..20763 - 705 WP_050442685 hypothetical protein -
L5468_RS28875 (L5468_28880) 21001..21393 - 393 WP_020805752 conjugal transfer relaxosome DNA-binding protein TraM -
L5468_RS28880 (L5468_28885) 21825..22310 + 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
L5468_RS28885 (L5468_28890) 22343..22672 - 330 WP_011977736 DUF5983 family protein -
L5468_RS28890 (L5468_28895) 22705..23526 - 822 WP_032454971 DUF932 domain-containing protein -
L5468_RS28895 (L5468_28900) 24342..24741 - 400 Protein_33 hypothetical protein -

Region 2: 105681..122258

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
L5468_RS29330 (L5468_29335) 105681..107993 - 2313 WP_032454979 type IV conjugative transfer system coupling protein TraD virb4
L5468_RS29335 (L5468_29340) 108120..108809 - 690 WP_013023831 hypothetical protein -
L5468_RS29340 (L5468_29345) 109002..109733 - 732 WP_013023830 conjugal transfer complement resistance protein TraT -
L5468_RS29345 (L5468_29350) 109924..110451 - 528 Protein_124 conjugal transfer protein TraS -
L5468_RS29350 (L5468_29355) 110454..113303 - 2850 WP_237437286 conjugal transfer mating-pair stabilization protein TraG traG
L5468_RS29355 (L5468_29360) 113303..114682 - 1380 WP_011977731 conjugal transfer pilus assembly protein TraH traH
L5468_RS29360 (L5468_29365) 114660..115103 - 444 WP_015065638 F-type conjugal transfer protein TrbF -
L5468_RS29365 (L5468_29370) 115148..115705 - 558 WP_004152678 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
L5468_RS29370 (L5468_29375) 115677..115916 - 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
L5468_RS29375 (L5468_29380) 115927..116679 - 753 WP_009309874 type-F conjugative transfer system pilin assembly protein TraF traF
L5468_RS29380 (L5468_29385) 116700..117026 - 327 WP_004194451 hypothetical protein -
L5468_RS29385 (L5468_29390) 117039..117287 - 249 WP_004152675 hypothetical protein -
L5468_RS29390 (L5468_29395) 117265..117519 - 255 WP_004195500 conjugal transfer protein TrbE -
L5468_RS29395 (L5468_29400) 117551..119505 - 1955 Protein_134 type-F conjugative transfer system mating-pair stabilization protein TraN -
L5468_RS29400 (L5468_29405) 119564..120202 - 639 WP_004193871 type-F conjugative transfer system pilin assembly protein TrbC trbC
L5468_RS29405 (L5468_29410) 120215..121204 - 990 WP_009309872 conjugal transfer pilus assembly protein TraU traU
L5468_RS29410 (L5468_29415) 121201..121590 - 390 WP_004194992 hypothetical protein -
L5468_RS29415 (L5468_29420) 121632..122258 - 627 WP_004152507 type-F conjugative transfer system protein TraW traW
L5468_RS29420 (L5468_29425) 122258..122647 - 390 WP_004167468 type-F conjugative transfer system protein TrbI -
L5468_RS29425 (L5468_29430) 122644..123504 - 861 Protein_140 type IV secretion system protein TraC -
L5468_RS29430 (L5468_29435) 123687..124386 - 700 Protein_141 DUF5934 domain-containing protein -


Host bacterium


ID   4264 GenBank   NZ_CP091585
Plasmid name   pR85_2-2 Incompatibility group   IncFII
Plasmid size   124386 bp Coordinate of oriT [Strand]   21704..21752 [+]
Host baterium   Klebsiella pneumoniae strain Nord9_R85

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -