Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 103823 |
| Name | oriT_pR85_2-1 |
| Organism | Klebsiella pneumoniae strain Nord9_R85 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP091584 (187997..188046 [-], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..14, 17..24 (GCAAAATT..AATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
TGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_pR85_2-1
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 2661 | GenBank | WP_237437270 |
| Name | traD_L5468_RS27730_pR85_2-1 |
UniProt ID | _ |
| Length | 768 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 768 a.a. Molecular weight: 85716.63 Da Isoelectric Point: 4.9254
>WP_237437270.1 type IV conjugative transfer system coupling protein TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSQPA
PAEVTVSPAPVKAPPTTKSPAAEPSARAAEPPVLQVTTVPLIKPKAAAAAAAAATASSVGTPAAGGTEQE
LAQQSAEQGQEMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINRSHRHDEQDDVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRRLDTRVDARLSALLEAREAEGSLARALFTPDAPEPGPADTDSHAGEQPEPVSQPA
PAEVTVSPAPVKAPPTTKSPAAEPSARAAEPPVLQVTTVPLIKPKAAAAAAAAATASSVGTPAAGGTEQE
LAQQSAEQGQEMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINRSHRHDEQDDVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 8482..24420
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5468_RS27610 (L5468_27615) | 3630..3826 | + | 197 | Protein_4 | hypothetical protein | - |
| L5468_RS27615 (L5468_27620) | 3827..4140 | + | 314 | Protein_5 | hypothetical protein | - |
| L5468_RS27620 (L5468_27625) | 4207..4609 | + | 403 | Protein_6 | hypothetical protein | - |
| L5468_RS27625 (L5468_27630) | 4652..4804 | + | 153 | WP_227850486 | hypothetical protein | - |
| L5468_RS27630 (L5468_27635) | 4985..5383 | + | 399 | WP_014343490 | hypothetical protein | - |
| L5468_RS27635 (L5468_27640) | 5455..8093 | + | 2639 | Protein_9 | type IV secretion system protein TraC | - |
| L5468_RS27640 (L5468_27645) | 8093..8482 | + | 390 | WP_013214025 | type-F conjugative transfer system protein TrbI | - |
| L5468_RS27645 (L5468_27650) | 8482..9117 | + | 636 | WP_013214026 | type-F conjugative transfer system protein TraW | traW |
| L5468_RS27650 (L5468_27655) | 9152..9553 | + | 402 | WP_004194979 | hypothetical protein | - |
| L5468_RS27655 (L5468_27660) | 9550..10539 | + | 990 | WP_013214027 | conjugal transfer pilus assembly protein TraU | traU |
| L5468_RS27660 (L5468_27665) | 10552..11190 | + | 639 | WP_004193871 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| L5468_RS27665 (L5468_27670) | 11249..13202 | + | 1954 | Protein_15 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| L5468_RS27670 (L5468_27675) | 13234..13488 | + | 255 | WP_004195500 | conjugal transfer protein TrbE | - |
| L5468_RS27675 (L5468_27680) | 13466..13714 | + | 249 | WP_004152675 | hypothetical protein | - |
| L5468_RS27680 (L5468_27685) | 13727..14053 | + | 327 | WP_086070807 | hypothetical protein | - |
| L5468_RS27685 (L5468_27690) | 14074..14826 | + | 753 | WP_046622841 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| L5468_RS27690 (L5468_27695) | 14837..15076 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| L5468_RS27695 (L5468_27700) | 15048..15605 | + | 558 | WP_237437268 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| L5468_RS27700 (L5468_27705) | 15651..16094 | + | 444 | WP_135689798 | F-type conjugal transfer protein TrbF | - |
| L5468_RS27705 (L5468_27710) | 16072..17451 | + | 1380 | WP_167876424 | conjugal transfer pilus assembly protein TraH | traH |
| L5468_RS27710 (L5468_27715) | 17451..20300 | + | 2850 | WP_237437269 | conjugal transfer mating-pair stabilization protein TraG | traG |
| L5468_RS27715 (L5468_27720) | 20306..20833 | + | 528 | WP_135689854 | conjugal transfer protein TraS | - |
| L5468_RS27720 (L5468_27725) | 21022..21753 | + | 732 | WP_004152629 | conjugal transfer complement resistance protein TraT | - |
| L5468_RS27725 (L5468_27730) | 21946..22032 | + | 87 | Protein_27 | hypothetical protein | - |
| L5468_RS27730 (L5468_27735) | 22114..24420 | + | 2307 | WP_237437270 | type IV conjugative transfer system coupling protein TraD | virb4 |
Region 2: 187439..211143
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L5468_RS28515 (L5468_28520) | 182465..182815 | + | 351 | WP_023287104 | hypothetical protein | - |
| L5468_RS28520 (L5468_28525) | 183446..183802 | + | 357 | WP_237437277 | hypothetical protein | - |
| L5468_RS28525 (L5468_28530) | 183863..184075 | + | 213 | WP_117087748 | hypothetical protein | - |
| L5468_RS28530 (L5468_28535) | 184086..184310 | + | 225 | WP_014343499 | hypothetical protein | - |
| L5468_RS28535 (L5468_28540) | 184391..184711 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| L5468_RS28540 (L5468_28545) | 184701..184979 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
| L5468_RS28545 (L5468_28550) | 184980..185393 | + | 414 | WP_023287139 | helix-turn-helix domain-containing protein | - |
| L5468_RS28550 (L5468_28555) | 186223..187044 | + | 822 | WP_032441618 | DUF932 domain-containing protein | - |
| L5468_RS28555 (L5468_28560) | 187077..187406 | + | 330 | WP_015065524 | DUF5983 family protein | - |
| L5468_RS28560 (L5468_28565) | 187439..187924 | - | 486 | WP_015065525 | transglycosylase SLT domain-containing protein | virB1 |
| L5468_RS28565 (L5468_28570) | 188315..188731 | + | 417 | WP_014343494 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| L5468_RS28570 (L5468_28575) | 188931..189668 | + | 738 | WP_013214018 | conjugal transfer protein TrbJ | - |
| L5468_RS28575 (L5468_28580) | 189783..189989 | + | 207 | WP_171773970 | TraY domain-containing protein | - |
| L5468_RS28580 (L5468_28585) | 190051..190419 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
| L5468_RS28585 (L5468_28590) | 190433..190738 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
| L5468_RS28590 (L5468_28595) | 190758..191324 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
| L5468_RS28595 (L5468_28600) | 191311..192051 | + | 741 | WP_013214019 | type-F conjugative transfer system secretin TraK | traK |
| L5468_RS28600 (L5468_28605) | 192051..193475 | + | 1425 | WP_023287137 | F-type conjugal transfer pilus assembly protein TraB | traB |
| L5468_RS28605 (L5468_28610) | 193548..194132 | + | 585 | WP_023287136 | type IV conjugative transfer system lipoprotein TraV | traV |
| L5468_RS28610 (L5468_28615) | 194455..194673 | + | 219 | WP_004195468 | hypothetical protein | - |
| L5468_RS28615 (L5468_28620) | 194674..194985 | + | 312 | WP_013214022 | hypothetical protein | - |
| L5468_RS28620 (L5468_28625) | 195052..195456 | + | 405 | WP_004197817 | hypothetical protein | - |
| L5468_RS28625 (L5468_28630) | 195833..196231 | + | 399 | WP_014343490 | hypothetical protein | - |
| L5468_RS28630 (L5468_28635) | 196303..198942 | + | 2640 | WP_013214024 | type IV secretion system protein TraC | virb4 |
| L5468_RS28635 (L5468_28640) | 198942..199331 | + | 390 | WP_013214025 | type-F conjugative transfer system protein TrbI | - |
| L5468_RS28640 (L5468_28645) | 199331..199966 | + | 636 | WP_013214026 | type-F conjugative transfer system protein TraW | traW |
| L5468_RS28645 (L5468_28650) | 200002..200403 | + | 402 | WP_004194979 | hypothetical protein | - |
| L5468_RS28650 (L5468_28655) | 200400..201389 | + | 990 | WP_013214027 | conjugal transfer pilus assembly protein TraU | traU |
| L5468_RS28655 (L5468_28660) | 201402..202040 | + | 639 | WP_004193871 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| L5468_RS28660 (L5468_28665) | 202099..204051 | + | 1953 | Protein_216 | type-F conjugative transfer system mating-pair stabilization protein TraN | - |
| L5468_RS28665 (L5468_28670) | 204083..204337 | + | 255 | WP_004195500 | conjugal transfer protein TrbE | - |
| L5468_RS28670 (L5468_28675) | 204315..204563 | + | 249 | WP_004152675 | hypothetical protein | - |
| L5468_RS28675 (L5468_28680) | 204605..204903 | + | 299 | Protein_219 | hypothetical protein | - |
| L5468_RS28680 (L5468_28685) | 204917..205670 | + | 754 | Protein_220 | type-F conjugative transfer system pilin assembly protein TraF | - |
| L5468_RS28685 (L5468_28690) | 205681..205920 | + | 240 | WP_023340931 | type-F conjugative transfer system pilin chaperone TraQ | - |
| L5468_RS28690 (L5468_28695) | 205892..206449 | + | 558 | WP_237437268 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| L5468_RS28695 (L5468_28700) | 206495..206938 | + | 444 | WP_135689798 | F-type conjugal transfer protein TrbF | - |
| L5468_RS28700 (L5468_28705) | 206916..208294 | + | 1379 | Protein_224 | conjugal transfer pilus assembly protein TraH | - |
| L5468_RS28705 (L5468_28710) | 208294..211143 | + | 2850 | WP_237437278 | conjugal transfer mating-pair stabilization protein TraG | traG |
| L5468_RS28710 (L5468_28715) | 211149..211676 | + | 528 | WP_135689854 | conjugal transfer protein TraS | - |
| L5468_RS28715 (L5468_28720) | 211865..212595 | + | 731 | Protein_227 | conjugal transfer complement resistance protein TraT | - |
| L5468_RS28720 (L5468_28725) | 212788..212874 | + | 87 | Protein_228 | hypothetical protein | - |
| L5468_RS29680 | 212955..214248 | + | 1294 | Protein_229 | type IV conjugative transfer system coupling protein TraD | - |
Host bacterium
| ID | 4263 | GenBank | NZ_CP091584 |
| Plasmid name | pR85_2-1 | Incompatibility group | IncFIB |
| Plasmid size | 214248 bp | Coordinate of oriT [Strand] | 187997..188046 [-] |
| Host baterium | Klebsiella pneumoniae strain Nord9_R85 |
Cargo genes
| Drug resistance gene | tet(D) |
| Virulence gene | - |
| Metal resistance gene | fecE, fecD, arsR, arsD, arsA, arsB, arsC, arsH, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silE |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | AcrIE9 |