Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   103790
Name   oriT_pTB44P3 in_silico
Organism   Escherichia fergusonii strain EF44
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP070957 (22689..22741 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pTB44P3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   2639 GenBank   WP_015059539
Name   t4cp2_JYG65_RS22995_pTB44P3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73404.02 Da        Isoelectric Point: 9.4339

>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 42441..58610

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JYG65_RS22850 (JYG65_22755) 38353..38805 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
JYG65_RS22855 (JYG65_22760) 38798..39013 + 216 WP_001127357 DUF1187 family protein -
JYG65_RS22860 (JYG65_22765) 39006..39182 + 177 WP_000753050 hypothetical protein -
JYG65_RS22865 (JYG65_22770) 39209..40162 + 954 WP_072089442 SPFH domain-containing protein -
JYG65_RS22870 (JYG65_22775) 40536..40979 + 444 WP_000964330 NfeD family protein -
JYG65_RS22875 (JYG65_22780) 40983..41153 + 171 WP_000550720 hypothetical protein -
JYG65_RS22880 (JYG65_22785) 41164..41610 + 447 WP_001243165 hypothetical protein -
JYG65_RS22885 (JYG65_22790) 41643..41900 + 258 WP_001542015 hypothetical protein -
JYG65_RS22890 (JYG65_22795) 41881..42183 + 303 WP_001360345 hypothetical protein -
JYG65_RS22895 (JYG65_22800) 42180..42437 + 258 WP_000739144 hypothetical protein -
JYG65_RS22900 (JYG65_22805) 42441..43436 + 996 WP_001028543 type IV secretion system protein virB6
JYG65_RS22905 (JYG65_22810) 43442..44083 + 642 WP_001425343 type IV secretion system protein -
JYG65_RS22910 (JYG65_22815) 44085..44339 + 255 WP_001043555 EexN family lipoprotein -
JYG65_RS22915 (JYG65_22820) 44352..44639 + 288 WP_001032611 EexN family lipoprotein -
JYG65_RS22920 (JYG65_22825) 44712..45347 + 636 WP_015059536 hypothetical protein -
JYG65_RS22925 (JYG65_22830) 45447..45698 + 252 WP_000121741 hypothetical protein -
JYG65_RS22930 (JYG65_22835) 45688..45969 + 282 WP_000638823 type II toxin-antitoxin system RelE/ParE family toxin -
JYG65_RS22935 (JYG65_22840) 46037..46336 + 300 WP_000835764 TrbM/KikA/MpfK family conjugal transfer protein -
JYG65_RS22940 (JYG65_22845) 46339..47574 + 1236 WP_015059538 TcpQ domain-containing protein -
JYG65_RS22945 (JYG65_22850) 47580..48017 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
JYG65_RS22950 (JYG65_22855) 48136..48534 + 399 WP_001153665 hypothetical protein -
JYG65_RS22955 (JYG65_22860) 48555..49139 + 585 WP_001177113 lytic transglycosylase domain-containing protein virB1
JYG65_RS22960 49139..49429 + 291 WP_000865479 conjugal transfer protein -
JYG65_RS22965 (JYG65_22870) 49500..49820 + 321 WP_000362080 VirB3 family type IV secretion system protein virB3
JYG65_RS22970 (JYG65_22875) 49826..52183 + 2358 WP_063078682 VirB4 family type IV secretion system protein virb4
JYG65_RS22975 (JYG65_22880) 52349..53083 + 735 WP_000432282 type IV secretion system protein virB8
JYG65_RS22980 (JYG65_22885) 53149..53850 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
JYG65_RS22985 (JYG65_22890) 53840..54979 + 1140 WP_000790640 TrbI/VirB10 family protein virB10
JYG65_RS22990 (JYG65_22895) 54998..56053 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
JYG65_RS22995 (JYG65_22900) 56069..58027 + 1959 WP_015059539 type IV secretory system conjugative DNA transfer family protein -
JYG65_RS23000 (JYG65_22905) 58074..58610 + 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
JYG65_RS23005 (JYG65_22910) 58603..60246 + 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
JYG65_RS23010 (JYG65_22915) 60297..60713 + 417 WP_223674109 type 4b pilus protein PilO2 -
JYG65_RS23015 (JYG65_22920) 60739..61952 + 1214 WP_162829202 IS3-like element IS1203 family transposase -


Host bacterium


ID   4230 GenBank   NZ_CP070957
Plasmid name   pTB44P3 Incompatibility group   IncI2
Plasmid size   62882 bp Coordinate of oriT [Strand]   22689..22741 [+]
Host baterium   Escherichia fergusonii strain EF44

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -