Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103771
Name   oriT_pGH44TC_vir in_silico
Organism   Klebsiella pneumoniae strain GH44TC
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MN543576 (157694..157721 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_pGH44TC_vir
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2628 GenBank   WP_101415807
Name   traD_H5F23_RS00370_pGH44TC_vir insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79581.14 Da        Isoelectric Point: 8.8191

>WP_101415807.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSVYVLIDSWTSKYGISEIPFYCSLGLIAMACWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRIINNAHFFADDRKYQKLVNLQESGGAPSKNRVYKLFRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPITRHYRKLAFDLGGNYAIFGVDKKVPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQDGLKEECESLGKPFMHFHAGTPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFLRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGNDWHLTVQVSQNLALADEIDKLKEYFYCNYFEDNSPKNLHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVANPNRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSASTKQSHTNFNGSISERKST
TMVSSIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVVDMVMTSPYKLKLRRNLDVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-654)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 215387..239432

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H5F23_RS01220 210618..210971 - 354 WP_072046272 hypothetical protein -
H5F23_RS01225 211116..212093 - 978 WP_128206178 hypothetical protein -
H5F23_RS01230 212426..214249 - 1824 WP_236935901 ATP-dependent helicase -
H5F23_RS01235 214506..215357 + 852 WP_004186952 hypothetical protein -
H5F23_RS01240 215387..218569 - 3183 WP_128206180 conjugal transfer protein TraN traN
H5F23_RS01245 218579..219616 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
H5F23_RS01250 219613..220974 - 1362 WP_128206181 TrbC family F-type conjugative pilus assembly protein traW
H5F23_RS01255 220961..221485 - 525 WP_128206182 signal peptidase I -
H5F23_RS01260 221623..225864 - 4242 WP_128206183 Ig-like domain-containing protein -
H5F23_RS01265 225992..226528 - 537 WP_032720870 hypothetical protein -
H5F23_RS01270 226516..226914 - 399 WP_101415758 hypothetical protein -
H5F23_RS01275 226895..227353 - 459 WP_032720872 hypothetical protein -
H5F23_RS01280 228039..228842 + 804 WP_099745297 metallophosphoesterase -
H5F23_RS01285 228832..229548 + 717 WP_116987722 hypothetical protein -
H5F23_RS01290 229535..230035 + 501 WP_099745299 hypothetical protein -
H5F23_RS01295 230010..230423 + 414 WP_072046239 trhZ -
H5F23_RS01300 230450..233167 - 2718 WP_116987720 TraC family protein virb4
H5F23_RS01305 233212..233949 - 738 WP_072046241 TraV family lipoprotein traV
H5F23_RS01310 233959..234810 - 852 WP_128206185 DsbC family protein -
H5F23_RS01315 234813..235277 - 465 WP_099745302 hypothetical protein -
H5F23_RS01320 235280..236653 - 1374 WP_176694865 TrbI/VirB10 family protein traB
H5F23_RS01325 236613..237131 - 519 WP_128206186 hypothetical protein -
H5F23_RS01330 237128..238297 - 1170 WP_099745304 type-F conjugative transfer system secretin TraK traK
H5F23_RS01335 238299..239159 - 861 WP_099745305 TraE/TraK family type IV conjugative transfer system protein traE
H5F23_RS01340 239178..239432 - 255 WP_236949613 type IV conjugative transfer system protein TraL traL
H5F23_RS01345 239582..239950 - 369 WP_072046247 pili assembly chaperone -
H5F23_RS01350 241216..241884 + 669 WP_128206187 hypothetical protein -
H5F23_RS01355 241939..242703 + 765 WP_099745345 hypothetical protein -
H5F23_RS01360 242831..244009 + 1179 WP_116987717 DNA-binding protein -

Host bacterium

ID   4211 GenBank   NZ_MN543576
Plasmid name   pGH44TC_vir Incompatibility group   IncFIB
Plasmid size   284388 bp Coordinate of oriT [Strand]   157694..157721 [+]
Host baterium   Klebsiella pneumoniae strain GH44TC

Cargo genes

Drug resistance gene   -
Virulence gene   iroB, iroC, iroD, iroN, rmpA, iucA, iucB, iucC, iutA, pla
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -