Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   103770
Name   oriT_pGH44TC_fusion in_silico
Organism   Klebsiella pneumoniae strain GH44TC
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_MN543575 (3746..3844 [-], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_pGH44TC_fusion
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   2627 GenBank   WP_101415807
Name   traD_H5F22_RS00350_pGH44TC_fusion insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79581.14 Da        Isoelectric Point: 8.8191

>WP_101415807.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSVYVLIDSWTSKYGISEIPFYCSLGLIAMACWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRIINNAHFFADDRKYQKLVNLQESGGAPSKNRVYKLFRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPITRHYRKLAFDLGGNYAIFGVDKKVPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQDGLKEECESLGKPFMHFHAGTPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFLRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGNDWHLTVQVSQNLALADEIDKLKEYFYCNYFEDNSPKNLHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVANPNRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSASTKQSHTNFNGSISERKST
TMVSSIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVVDMVMTSPYKLKLRRNLDVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-654)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 220718..244811

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H5F22_RS01200 215949..216302 - 354 WP_072046272 hypothetical protein -
H5F22_RS01205 216447..217424 - 978 WP_128206178 hypothetical protein -
H5F22_RS01210 217757..219580 - 1824 WP_236935901 ATP-dependent helicase -
H5F22_RS01215 219837..220688 + 852 WP_004186952 hypothetical protein -
H5F22_RS01220 220718..223900 - 3183 WP_128206180 conjugal transfer protein TraN traN
H5F22_RS01225 223910..224947 - 1038 WP_004026524 IncHI-type conjugal transfer protein TrhU traU
H5F22_RS01230 224944..226305 - 1362 WP_128206181 TrbC family F-type conjugative pilus assembly protein traW
H5F22_RS01235 226292..226816 - 525 WP_128206182 signal peptidase I -
H5F22_RS01240 226954..231195 - 4242 WP_128206183 Ig-like domain-containing protein -
H5F22_RS01245 231323..231859 - 537 WP_032720870 hypothetical protein -
H5F22_RS01250 231847..232167 - 321 WP_236935902 hypothetical protein -
H5F22_RS01255 232226..232684 - 459 WP_032720872 hypothetical protein -
H5F22_RS01260 233370..234173 + 804 WP_099745297 metallophosphoesterase -
H5F22_RS01265 234163..234879 + 717 WP_116987722 hypothetical protein -
H5F22_RS01270 234866..235366 + 501 WP_099745299 hypothetical protein -
H5F22_RS01275 235341..235754 + 414 WP_072046239 trhZ -
H5F22_RS01280 235781..238498 - 2718 WP_116987720 TraC family protein virb4
H5F22_RS01285 238543..239280 - 738 WP_072046241 TraV family lipoprotein traV
H5F22_RS01290 239290..240141 - 852 WP_128206185 DsbC family protein -
H5F22_RS01295 240144..240608 - 465 WP_099745302 hypothetical protein -
H5F22_RS01300 240611..241984 - 1374 WP_176694865 TrbI/VirB10 family protein traB
H5F22_RS01305 241944..242462 - 519 WP_128206186 hypothetical protein -
H5F22_RS01310 242459..243628 - 1170 WP_099745304 type-F conjugative transfer system secretin TraK traK
H5F22_RS01315 243630..244490 - 861 WP_099745305 TraE/TraK family type IV conjugative transfer system protein traE
H5F22_RS01320 244509..244811 - 303 WP_099745306 type IV conjugative transfer system protein TraL traL
H5F22_RS01325 244913..245281 - 369 WP_072046247 pili assembly chaperone -
H5F22_RS01330 246547..247215 + 669 WP_128206187 hypothetical protein -
H5F22_RS01335 247270..248034 + 765 WP_099745345 hypothetical protein -
H5F22_RS01340 248162..249340 + 1179 WP_116987717 DNA-binding protein -

Host bacterium

ID   4210 GenBank   NZ_MN543575
Plasmid name   pGH44TC_fusion Incompatibility group   IncR
Plasmid size   327581 bp Coordinate of oriT [Strand]   3746..3844 [-]
Host baterium   Klebsiella pneumoniae strain GH44TC

Cargo genes

Drug resistance gene   aadA2, cmlA1, ant(3'')-Ia, sul3
Virulence gene   iroB, iroC, iroD, iroN, rmpA, iucA, iucB, iucC, iutA, pla
Metal resistance gene   terE, terD, terC, terB, terA, terZ, terW
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -